• Gene id: 10443

Gene Summary

• Gene Symbol: N4BP2L2   Gene   UCSC   Ensembl
• Aliases: 92M18.3, CG005, CG016, PFAAP5
• Gene name: NEDD4 binding protein 2 like 2
• Alternate names: NEDD4-binding protein 2-like 2, phosphonoformate immuno-associated protein 5, protein from BRCA2 region,
• Gene location: 13q13.1 (32542709: 32432416)     Exons: 6     NC_000013.11
• OMIM: 615788

Protein Summary

• Protein general information: Q92802  
  • Name: NEDD4 binding protein 2 like 2 (Phosphonoformate immuno associated protein 5)
  • Length: 583  
  • Mass: 67459
• Sequence:

  MSYGEIEGKFLGPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTIIDVRGHSYLQENKIKT
  TDLHRPLHDEMPGNRPDVIESIDSQVLQEARPPLVSADDEIYSTSKAFIGPIYKPPEKKKRNEGRNEAHVLNGIN
  DRGGQKEKQKFNSEKSEIDNELFQFYKEIEELEKEKDGFENSCKESEPSQEQFVPFYEGHNNGLLKPDEEKKDLS
  NKAMPSHCDYQQNLGNEPDKYPCNGQVIPTFCDTSFTSFRPEWQSVYPFIVPYGPPLPSLNYHLNIQRFSGPPNP
  PSNIFQAQDDSQIQNGYYVNNCHVNWNCMTFDQNNEYTDCSENRSSVHPSGNGCSMQDRYVSNGFCEVRERCWKD
  HCMDKHNGTDRFVNQQFQEEKLNKLQKLLILLRGLPGSGKTTLSRILLGQNRDGIVFSTDDYFHHQDGYRYNVNQ
  LGDAHDWNQNRAKQAIDQGRSPVIIDNTNIQAWEMKPYVEVAIGKGYRVEFHEPETWWKFDPEELEKRNKHGVSR
  KKIAQMLDRYEYQMSISIVMNSVEPSHKSTQRPPPPQGRQRWGGSLGSHNRVCVTNNH

• Structural information:
  • Interpro: IPR026568  IPR026302  IPR027417  
  • STRING: ENSP00000382328
• Other Databases: GeneCards:  N4BP2L2  Malacards:  N4BP2L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0003714	transcription corepressor activity	ISS	molecular function
GO:0003674	molecular_function	ND	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:1902037	negative regulation of hematopoietic stem cell differentiation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:1902035	positive regulation of hematopoietic stem cell proliferation	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 21412036
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq