• Gene id: 10440

Gene Summary

• Gene Symbol: TIMM17A   Gene   UCSC   Ensembl
• Aliases: TIM17, TIM17A
• Gene name: translocase of inner mitochondrial membrane 17A
• Alternate names: mitochondrial import inner membrane translocase subunit Tim17-A, inner membrane preprotein translocase Tim17a, mitochondrial inner membrane translocase, preprotein translocase, translocase of inner mitochondrial membrane 17 homolog A,
• Gene location: 1q32.1 (201955502: 201970663)     Exons: 6     NC_000001.11
• OMIM: 0

Protein Summary

• Protein general information: Q99595  
  • Name: Mitochondrial import inner membrane translocase subunit Tim17 A (Inner membrane preprotein translocase Tim17a)
  • Length: 171  
  • Mass: 18024
• Sequence:

  MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSM
  IDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAED
  PSQLPSTQLPSSPFGDYRQYQ

• Structural information:
  • Interpro: IPR005678  
  • STRING: ENSP00000356256
• Other Databases: GeneCards:  TIMM17A  Malacards:  TIMM17A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031305	integral component of mitochondrial inner membrane	IBA	cellular component
GO:0005744	TIM23 mitochondrial import inner membrane translocase complex	IBA	cellular component
GO:0030150	protein import into mitochondrial matrix	IBA	biological process
GO:0005744	TIM23 mitochondrial import inner membrane translocase complex	IEA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0015450	P-P-bond-hydrolysis-driven protein transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006626	protein targeting to mitochondrion	TAS	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0010954	positive regulation of protein processing	IEA	biological process
GO:0005744	TIM23 mitochondrial import inner membrane translocase complex	IDA	cellular component
GO:0031305	integral component of mitochondrial inner membrane	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)