• Gene id: 1044

Gene Summary

• Gene Symbol: CDX1   Gene   UCSC   Ensembl
• Gene name: caudal type homeobox 1
• Alternate names: homeobox protein CDX-1, caudal type homeo box transcription factor 1, caudal type homeobox transcription factor 1, caudal-type homeobox protein 1, caudal-type homeobox protein CDX1,
• Gene location: 5q32 (150166777: 150184557)     Exons: 3     NC_000005.10
• Gene summary(Entrez): This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal al

Protein Summary

• Protein general information: P47902  
  • Name: Homeobox protein CDX 1 (Caudal type homeobox protein 1)
  • Length: 265  
  • Mass: 28138
  • Tissue specificity: Intestinal epithelium.
• Sequence:

  MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAA
  YGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSVAAGGGGGSGK
  TRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQP
  PMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP

• Structural information:
  • Interpro: IPR006820  IPR009057  IPR017970  IPR001356  IPR020479   IPR000047  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • PDB: 5LUX
  • PDBsum: 5LUX
  • STRING: ENSP00000231656
• Other Databases: GeneCards:  CDX1  Malacards:  CDX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0009887	animal organ morphogenesis	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0009948	anterior/posterior axis specification	IBA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0008327	methyl-CpG binding	IDA	molecular function
GO:0014807	regulation of somitogenesis	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0014807	regulation of somitogenesis	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0060349	bone morphogenesis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0007389	pattern specification process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq