• Gene id: 10439

Gene Summary

• Gene Symbol: OLFM1   Gene   UCSC   Ensembl
• Aliases: AMY, NOE1, NOELIN1, OlfA
• Gene name: olfactomedin 1
• Alternate names: noelin, neuroblastoma protein, neuronal olfactomedin-related ER localized protein, olfactomedin related ER localized protein, pancortin 1,
• Gene location: 9q34.3 (85259676: 85249952)     Exons: 4     NC_000001.11
• Gene summary(Entrez): This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential r
• OMIM: 605366

Protein Summary

• Protein general information: Q99784  
  • Name: Noelin (Neuronal olfactomedin related ER localized protein) (Olfactomedin 1)
  • Length: 485  
  • Mass: 55343
• Sequence:

  MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTGVLPTNPEESWQVYSSAQDSEGRCIC
  TVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLARQ
  FKAIKAKMDELRPLIPVLEEYKADAKLVLQFKEEVQNLTSVLNELQEEIGAYDYDELQSRVSNLEERLRACMQKL
  ACGKLTGISDPVTVKTSGSRFGSWMTDPLAPEGDNRVWYMDGYHNNRFVREYKSMVDFMNTDNFTSHRLPHPWSG
  TGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDLMVDESGLWAVYATNQNAG
  NIVVSRLDPVSLQTLQTWNTSYPKRSAGEAFIICGTLYVTNGYSGGTKVHYAYQTNASTYEYIDIPFQNKYSHIS
  MLDYNPKDRALYAWNNGHQILYNVTLFHVIRSDEL

• Structural information:
  • Protein Domains: (226..47-)
    (/note="Olfactomedin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00446"-)
  • Interpro: IPR031217  IPR022082  IPR003112  IPR011044  
  • Prosite: PS00014 PS51132
  • PDB: 4XAT 6QHJ
  • PDBsum: 4XAT 6QHJ
  • STRING: ENSP00000360858
• Other Databases: GeneCards:  OLFM1  Malacards:  OLFM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0023041	neuronal signal transduction	ISS	biological process
GO:0044295	axonal growth cone	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005615	extracellular space	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0030516	regulation of axon extension	ISS	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0005623	obsolete cell	ISS	cellular component
GO:0060317	cardiac epithelial to mesenchymal transition	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010718	positive regulation of epithelial to mesenchymal transition	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0003190	atrioventricular valve formation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq