• Gene id: 10438

Gene Summary

• Gene Symbol: C1D   Gene   UCSC   Ensembl
• Aliases: LRP1, Rrp47, SUN-CoR, SUNCOR, hC1D
• Gene name: C1D nuclear receptor corepressor
• Alternate names: nuclear nucleic acid-binding protein C1D, C1D DNA-binding protein, C1D nuclear receptor co-repressor, nuclear DNA-binding protein, small unique nuclear receptor co-repressor, small unique nuclear receptor corepressor,
• Gene location: 2p14 (68063003: 68041129)     Exons: 6     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/
• OMIM: 606997

Protein Summary

• Protein general information: Q13901  
  • Name: Nuclear nucleic acid binding protein C1D (hC1D)
  • Length: 141  
  • Mass: 16019
  • Tissue specificity: Ubiquitous. Expressed at very high levels in the hippocampus, medulla oblongata, mammary gland, thyroid and salivary gland. Expressed at high levels in the fetal; lung, liver and kidney. Expressed at low levels in skeletal muscle, appe
• Sequence:

  MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQG
  VNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS

• Structural information:
  • Interpro: IPR011082  IPR007146  
  • STRING: ENSP00000348107
• Other Databases: GeneCards:  C1D  Malacards:  C1D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:0000460	maturation of 5.8S rRNA	IBA	biological process
GO:0000178	exosome (RNase complex)	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0003677	DNA binding	IBA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0000460	maturation of 5.8S rRNA	IMP	biological process
GO:0000176	nuclear exosome (RNase complex)	TAS	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006364	rRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0003677	DNA binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0016922	nuclear receptor binding	IEA	molecular function
GO:0017053	transcription repressor complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq