• Gene id: 10434

Gene Summary

• Gene Symbol: LYPLA1   Gene   UCSC   Ensembl
• Aliases: APT-1, APT1, LPL-I, LPL1, hAPT1
• Gene name: lysophospholipase 1
• Alternate names: acyl-protein thioesterase 1, lysoPLA I, lysophospholipase I, lysophospholipid-specific lysophospholipase,
• Gene location: 8q11.23 (118935158: 118813454)     Exons: 18     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the alpha/beta hydrolase superfamily. The encoded protein functions as a homodimer, exhibiting both depalmitoylating as well as lysophospholipase activity, and may be involved in Ras localization and signaling. Alternate spli
• OMIM: 605599

Protein Summary

• Protein general information: O75608  
  • Name: Acyl protein thioesterase 1 (APT 1) (hAPT1) (EC 3.1.2. ) (Lysophospholipase 1) (Lysophospholipase I) (LPL I) (LysoPLA I)
  • Length: 230  
  • Mass: 24670
  • Tissue specificity: Platelets. {ECO
• Sequence:

  MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDI
  IGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRA
  SFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKL
  LPPID

• Structural information:
  • Interpro: IPR029058  IPR003140  
  • PDB: 1FJ2 5SYM
  • PDBsum: 1FJ2 5SYM
  • STRING: ENSP00000320043
• Other Databases: GeneCards:  LYPLA1  Malacards:  LYPLA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016298	lipase activity	IDA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0008474	palmitoyl-(protein) hydrolase activity	IBA	molecular function
GO:0052689	carboxylic ester hydrolase activity	IBA	molecular function
GO:0002084	protein depalmitoylation	IBA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0004622	lysophospholipase activity	IDA	molecular function
GO:0004620	phospholipase activity	IDA	molecular function
GO:0004622	lysophospholipase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0008474	palmitoyl-(protein) hydrolase activity	IDA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004622	lysophospholipase activity	TAS	molecular function
GO:0050999	regulation of nitric-oxide synthase activity	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042997	negative regulation of Golgi to plasma membrane protein transport	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0002084	protein depalmitoylation	IEA	biological process
GO:0008474	palmitoyl-(protein) hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008474	palmitoyl-(protein) hydrolase activity	IMP	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00564	Glycerophospholipid metabolism
hsa05231	Choline metabolism in cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray