• Gene id: 1043

Gene Summary

• Gene Symbol: CD52   Gene   UCSC   Ensembl
• Aliases: CDW52, EDDM5
• Gene name: CD52 molecule
• Alternate names: CAMPATH-1 antigen, CD52 antigen (CAMPATH-1 antigen), CDW52 antigen (CAMPATH-1 antigen), HEL-S-171mP, cambridge pathology 1 antigen, epididymal secretory protein E5, epididymis secretory sperm binding protein Li 171mP, he5, human epididymis-specific protei,
• Gene location: 1p36.11 (26317919: 26320522)     Exons: 2     NC_000001.11
• OMIM: 114280

Protein Summary

• Protein general information: P31358  
  • Name: CAMPATH 1 antigen (CDw52) (Cambridge pathology 1 antigen) (Epididymal secretory protein E5) (Human epididymis specific protein 5) (He5) (CD antigen CD52)
  • Length: 61  
  • Mass: 6,614
• Sequence:

  MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS

• Structural information:
  • Interpro: IPR026643  
  • STRING: ENSP00000363330
• Other Databases: GeneCards:  CD52  Malacards:  CD52

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0016020	membrane	TAS	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0045730	respiratory burst	NAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0045730	respiratory burst	NAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0016020	membrane	TAS	cellular component
GO:0045730	respiratory burst	NAS	biological process

Diseases

Associated diseases	References
Female infertility	INFBASE: 10428755
Unexplained infertility	MIK: 24597237
Role in sperm maturation	MIK: 9464849
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 24597237

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24597237	Unexplained infertility			20 normozoospermic infertile men	Male infertility	CD52 CD69 CD98 fMLP HI307 and 80280
9464849	Role in sperm maturation				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)