• Gene id: 10426

Gene Summary

• Gene Symbol: TUBGCP3   Gene   UCSC   Ensembl
• Aliases: 104p, ALP6, GCP3, Grip104, SPBC98, Spc98, Spc98p
• Gene name: tubulin gamma complex associated protein 3
• Alternate names: gamma-tubulin complex component 3, gamma-ring complex protein 104 kDa, spindle pole body protein Spc98 homolog,
• Gene location: 13q34 (112606468: 112485004)     Exons: 4     NC_000013.11
• OMIM: 617818

Protein Summary

• Protein general information: Q96CW5  
  • Name: Gamma tubulin complex component 3 (GCP 3) (hGCP3) (Gamma ring complex protein 104 kDa) (h104p) (hGrip104) (Spindle pole body protein Spc98 homolog) (hSpc98)
  • Length: 907  
  • Mass: 103571
  • Tissue specificity: Ubiquitously expressed.
• Sequence:

  MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREADAALFS
  ELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQS
  AQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSA
  VSRNMTRSRREGDTGGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWL
  HNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPK
  IRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVAS
  DPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTD
  LENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGI
  LETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLRVFNFLWRAKRMEY
  ILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAA
  HEVFLDTIISRCLLDSDSRALLNQLRAVFDQIIELQNAQDAIYRAALEELQRRLQFEEKKKQREIEGQWGVTAAE
  EEEENKRIGEFKESIPKMCSQLRILTHFYQGIVQQFLVLLTTSSDESLRFLSFRLDFNEHYKAREPRLRVSLGTR
  GRRSSHT

• Structural information:
  • Interpro: IPR007259  IPR040457  IPR041470  
  • PDB: 6V6B 6V6S
  • PDBsum: 6V6B 6V6S
  • STRING: ENSP00000261965
• Other Databases: GeneCards:  TUBGCP3  Malacards:  TUBGCP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0000923	equatorial microtubule organizing center	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0008275	gamma-tubulin small complex	IBA	cellular component
GO:0031122	cytoplasmic microtubule organization	IBA	biological process
GO:0051321	meiotic cell cycle	IBA	biological process
GO:0051415	microtubule nucleation by interphase microtubule organizing center	IBA	biological process
GO:0000930	gamma-tubulin complex	IBA	cellular component
GO:0043015	gamma-tubulin binding	IBA	molecular function
GO:0051011	microtubule minus-end binding	IBA	contributes to
GO:0051225	spindle assembly	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007020	microtubule nucleation	IEA	biological process
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0000922	spindle pole	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0043015	gamma-tubulin binding	IEA	molecular function
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005198	structural molecule activity	NAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0043015	gamma-tubulin binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0005827	polar microtubule	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005819	spindle	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007338	single fertilization	NAS	biological process
GO:0007020	microtubule nucleation	NAS	biological process
GO:0005200	structural constituent of cytoskeleton	NAS	molecular function
GO:0007020	microtubule nucleation	NAS	biological process
GO:0005813	centrosome	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq