• Gene id: 10421

Gene Summary

• Gene Symbol: CD2BP2   Gene   UCSC   Ensembl
• Aliases: FWP010, LIN1, PPP1R59, Snu40, U5-52K
• Gene name: CD2 cytoplasmic tail binding protein 2
• Alternate names: CD2 antigen cytoplasmic tail-binding protein 2, CD2 cytoplasmic domain-binding protein 2, U5 snRNP 52K protein, protein phosphatase 1, regulatory subunit 59,
• Gene location: 16p11.2 (30355307: 30350765)     Exons: 7     NC_000016.10
• Gene summary(Entrez): This gene encodes a bi-functional protein. In the cytoplasm, the encoded protein binds the cytoplasmic tail of human surface antigen CD2 via its C-terminal GYF domain, and regulate CD2-triggered T lymphocyte activation. In the nucleus, this protein is a c
• OMIM: 604470

Protein Summary

• Protein general information: O95400  
  • Name: CD2 antigen cytoplasmic tail binding protein 2 (CD2 cytoplasmic domain binding protein 2) (CD2 tail binding protein 2) (U5 snRNP 52K protein) (U5 52K)
  • Length: 341  
  • Mass: 37646
• Sequence:

  MPKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSDEEEDDDDGGSSKYDILASEDVEGQE
  AATLPSEGGVRITPFNLQEEMEEGHFDADGNYFLNRDAQIRDSWLDNIDWVKIRERPPGQRQASDSEEEDSLGQT
  SMSAQALLEGLLELLLPRETVAGALRRLGARGGGKGRKGPGQPSSPQRLDRLSGLADQMVARGNLGVYQETRERL
  AMRLKGLGCQTLGPHNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFT
  SAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

• Structural information:
  • Protein Domains: (280..33-)
    (/note="GYF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00101"-)
  • Interpro: IPR039905  IPR003169  IPR035445  
  • Prosite: PS50829
  • CDD: cd00072
  • PDB: 1GYF 1L2Z 1SYX 4BWS
  • PDBsum: 1GYF 1L2Z 1SYX 4BWS
  • STRING: ENSP00000304903
• Other Databases: GeneCards:  CD2BP2  Malacards:  CD2BP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005682	U5 snRNP	IBA	cellular component
GO:0010923	negative regulation of phosphatase activity	IDA	biological process
GO:0005682	U5 snRNP	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043021	ribonucleoprotein complex binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005682	U5 snRNP	IDA	cellular component
GO:0016607	nuclear speck	IDA	colocalizes with
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	NOT|cellular component
GO:0000244	spliceosomal tri-snRNP complex assembly	NAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881