• Gene id: 10420

Gene Summary

• Gene Symbol: TESK2   Gene   UCSC   Ensembl
• Gene name: testis associated actin remodelling kinase 2
• Alternate names: dual specificity testis-specific protein kinase 2, testicular protein kinase 2, testis-specific kinase 2,
• Gene location: 1p34.1 (45491162: 45343882)     Exons: 11     NC_000001.11
• Gene summary(Entrez): This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain that is structurally similar to the kinase domains of testis-specific protein kinase-1 and the LIM motif-containing protein kinases (LIMKs). Its overa
• OMIM: 604885

Protein Summary

• Protein general information: Q96S53  
  • Name: Dual specificity testis specific protein kinase 2 (EC 2.7.12.1) (Testicular protein kinase 2)
  • Length: 571  
  • Mass: 63639
  • Tissue specificity: Predominantly expressed in testis and prostate. Found predominantly in non-germinal Sertoli cells. {ECO
• Sequence:

  MDRSKRNSIAGFPPRVERLEEFEGGGGGEGNVSQVGRVWPSSYRALISAFSRLTRLDDFTCEKIGSGFFSEVFKV
  RHRASGQVMALKMNTLSSNRANMLKEVQLMNRLSHPNILRFMGVCVHQGQLHALTEYINSGNLEQLLDSNLHLPW
  TVRVKLAYDIAVGLSYLHFKGIFHRDLTSKNCLIKRDENGYSAVVADFGLAEKIPDVSMGSEKLAVVGSPFWMAP
  EVLRDEPYNEKADVFSYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLTFNCCNMDPKLRP
  SFVEIGKTLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVKRLSSLDDKIPHKSPCPRRTIWLSRSQSDIFSRK
  PPRTVSVLDPYYRPRDGAARTPKVNPFSARQDLMGGKIKFFDLPSKSVISLVFDLDAPGPGTMPLADWQEPLAPP
  IRRWRSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSILQEENGFG
  SRPQGTSPCPAGASEEMEVEERPAGSTPATFSTSGIGLQTQGKQDG

• Structural information:
  • Protein Domains: (58..31-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR001245  IPR008266  
  • Prosite: PS00107 PS50011 PS00109
  • STRING: ENSP00000361158
• Other Databases: GeneCards:  TESK2  Malacards:  TESK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	TAS	molecular function
GO:0007283	spermatogenesis	TAS	biological process
GO:0004712	protein serine/threonine/tyrosine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048041	focal adhesion assembly	IEA	biological process
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0048041	focal adhesion assembly	ISS	biological process
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0030036	actin cytoskeleton organization	ISS	biological process
GO:0007283	spermatogenesis	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq