• Gene id: 10417

Gene Summary

• Gene Symbol: SPON2   Gene   UCSC   Ensembl
• Aliases: DIL-1, DIL1, M-SPONDIN, MINDIN
• Gene name: spondin 2
• Alternate names: spondin-2, differentially expressed in cancerous and non-cancerous lung cells 1, spondin 2, extracellular matrix protein,
• Gene location: 4p16.3 (1208961: 1166931)     Exons: 9     NC_000004.12
• OMIM: 604746

Protein Summary

• Protein general information: Q9BUD6  
  • Name: Spondin 2 (Differentially expressed in cancerous and non cancerous lung cells 1) (DIL 1) (Mindin)
  • Length: 331  
  • Mass: 35846
  • Tissue specificity: Expressed in normal lung tissue but not in lung carcinoma cell lines. {ECO
• Sequence:

  MENPSPAAALGKALCALLLATLGAAGQPLGGESICSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGA
  AHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAELEVQRRHSLVS
  FVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSF
  YYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKS
  RTRYVRVQPANNGSPCPELEEEAECVPDNCV

• Structural information:
  • Protein Domains: (31..22-)
    (/note="Spondin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00364-)
    (277..33-)
    (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00210"-)
  • Interpro: IPR009465  IPR038678  IPR000884  IPR036383  
  • Prosite: PS51020 PS50092
  • PDB: 3D34
  • PDBsum: 3D34
  • STRING: ENSP00000483599
• Other Databases: GeneCards:  SPON2  Malacards:  SPON2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007155	cell adhesion	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001530	lipopolysaccharide binding	IEA	molecular function
GO:0002448	mast cell mediated immunity	IEA	biological process
GO:0003823	antigen binding	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0043152	induction of bacterial agglutination	IEA	biological process
GO:0060907	positive regulation of macrophage cytokine production	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0008228	opsonization	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0050832	defense response to fungus	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq