• Gene id: 10413

Gene Summary

• Gene Symbol: YAP1   Gene   UCSC   Ensembl
• Aliases: COB1, YAP, YAP2, YAP65, YKI
• Gene name: Yes1 associated transcriptional regulator
• Alternate names: transcriptional coactivator YAP1, 65 kDa Yes-associated protein, Yes associated protein 1, protein yorkie homolog, yes-associated protein 1, yes-associated protein 2, yes-associated protein YAP65 homolog, yorkie homolog,
• Gene location: 11q22.1 (102109956: 102233423)     Exons: 10     NC_000011.10
• Gene summary(Entrez): This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional
• OMIM: 606608

Protein Summary

• Protein general information: P46937  
  • Name: Transcriptional coactivator YAP1 (Yes associated protein 1) (Protein yorkie homolog) (Yes associated protein YAP65 homolog)
  • Length: 504  
  • Mass: 54462
  • Tissue specificity: Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level). {ECO
• Sequence:

  MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNP
  KTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSG
  PAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMM
  NSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNS
  NQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELR
  TMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPG
  TNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

• Structural information:
  • Protein Domains: (171..20-)
    (/note="WW-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (230..26-)
    (/note="WW-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224"-)
  • Interpro: IPR001202  IPR036020  
  • Prosite: PS01159 PS50020
  • CDD: cd00201
  • PDB: 1JMQ 1K5R 1K9Q 1K9R 2LAW 2LAX 2LAY 2LTV 2LTW 3KYS 3MHR 4RE1 4REX 5OAQ 5YDX 5YDY 6G6X 6G8I 6G8J 6G8K 6G8L 6G8P 6G8Q 6GE3 6GE4 6GE5 6GE6 6GEC 6GEE 6GEG 6GEI 6GEK 6HIK 6HIL 6Q2X
  • PDBsum: 1JMQ 1K5R 1K9Q 1K9R 2LAW 2LAX 2LAY 2LTV 2LTW 3KYS 3MHR 4RE1 4REX 5OAQ 5YDX 5YDY 6G6X 6G8I 6G8J 6G8K 6G8L 6G8P 6G8Q 6GE3 6GE4 6GE5 6GE6 6GEC 6GEE 6GEG 6GEI 6GEK 6HIK 6HIL 6Q2X
  • DIP: 40839
  • STRING: ENSP00000478927
• Other Databases: GeneCards:  YAP1  Malacards:  YAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:1904036	negative regulation of epithelial cell apoptotic process	IMP	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0035329	hippo signaling	IBA	biological process
GO:0060242	contact inhibition	IDA	biological process
GO:0008283	cell population proliferation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0032570	response to progesterone	IDA	biological process
GO:0033148	positive regulation of intracellular estrogen receptor signaling pathway	IDA	biological process
GO:0045747	positive regulation of Notch signaling pathway	IDA	biological process
GO:0070102	interleukin-6-mediated signaling pathway	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0050847	progesterone receptor signaling pathway	IDA	biological process
GO:0060576	intestinal epithelial cell development	IDA	biological process
GO:0035329	hippo signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0072091	regulation of stem cell proliferation	IDA	biological process
GO:0050767	regulation of neurogenesis	IDA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0035329	hippo signaling	TAS	biological process
GO:1902036	regulation of hematopoietic stem cell differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000737	negative regulation of stem cell differentiation	IEA	biological process
GO:0072307	regulation of metanephric nephron tubule epithelial cell differentiation	IEA	biological process
GO:0061026	cardiac muscle tissue regeneration	IEA	biological process
GO:0060449	bud elongation involved in lung branching	IEA	biological process
GO:0060045	positive regulation of cardiac muscle cell proliferation	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0035329	hippo signaling	IEA	biological process
GO:0030903	notochord development	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0003682	chromatin binding	IEA	molecular function
GO:0001570	vasculogenesis	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000902	cell morphogenesis	IEA	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:1902459	positive regulation of stem cell population maintenance	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0072091	regulation of stem cell proliferation	IEA	biological process
GO:0071300	cellular response to retinoic acid	IEA	biological process
GO:0070064	proline-rich region binding	IEA	molecular function
GO:0060828	regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0060487	lung epithelial cell differentiation	IEA	biological process
GO:0048368	lateral mesoderm development	IEA	biological process
GO:0048339	paraxial mesoderm development	IEA	biological process
GO:0046622	positive regulation of organ growth	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0035019	somatic stem cell population maintenance	IEA	biological process
GO:0030857	negative regulation of epithelial cell differentiation	IEA	biological process
GO:0030216	keratinocyte differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0010837	regulation of keratinocyte proliferation	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003143	embryonic heart tube morphogenesis	IEA	biological process
GO:0003015	heart process	IEA	biological process
GO:0001894	tissue homeostasis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IMP	molecular function
GO:0065003	protein-containing complex assembly	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0140297	DNA-binding transcription factor binding	IPI	molecular function
GO:0071148	TEAD-1-YAP complex	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0071149	TEAD-2-YAP complex	IDA	cellular component
GO:0065003	protein-containing complex assembly	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0071480	cellular response to gamma radiation	IDA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04390	Hippo signaling pathway
hsa04392	Hippo signaling pathway - multiple species

Diseases

Associated diseases	References
Ocular coloboma	KEGG:H01114
Ocular coloboma	KEGG:H01114
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881