• Gene id: 10410

Gene Summary

• Gene Symbol: IFITM3   Gene   UCSC   Ensembl
• Aliases: 1-8U, DSPA2b, IP15
• Gene name: interferon induced transmembrane protein 3
• Alternate names: interferon-induced transmembrane protein 3, dispanin subfamily A member 2b, interferon-inducible protein 1-8U,
• Gene location: 11p15.5 (320859: 319675)     Exons: 5     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is an interferon-induced membrane protein that helps confer immunity to influenza A H1N1 virus, West Nile virus, and dengue virus. Two transcript variants, only one of them protein-coding, have been found for this gene. An
• OMIM: 605579

Protein Summary

• Protein general information: Q01628  
  • Name: Interferon induced transmembrane protein 3 (Dispanin subfamily A member 2b) (DSPA2b) (Interferon inducible protein 1 8U)
  • Length: 133  
  • Mass: 14632
• Sequence:

  MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGF
  IAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG

• Structural information:
  • Interpro: IPR007593  
  • STRING: ENSP00000382707
• Other Databases: GeneCards:  IFITM3  Malacards:  IFITM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046597	negative regulation of viral entry into host cell	IMP	biological process
GO:0034341	response to interferon-gamma	IBA	biological process
GO:0035455	response to interferon-alpha	IBA	biological process
GO:0045071	negative regulation of viral genome replication	IBA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0060337	type I interferon signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0035456	response to interferon-beta	IBA	biological process
GO:0046597	negative regulation of viral entry into host cell	IBA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0035455	response to interferon-alpha	IDA	biological process
GO:0034341	response to interferon-gamma	IDA	biological process
GO:0032897	negative regulation of viral transcription	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0046597	negative regulation of viral entry into host cell	IDA	biological process
GO:0046597	negative regulation of viral entry into host cell	IDA	biological process
GO:0035456	response to interferon-beta	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0051607	defense response to virus	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006955	immune response	TAS	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0051607	defense response to virus	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R