• Gene id: 10409

Gene Summary

• Gene Symbol: BASP1   Gene   UCSC   Ensembl
• Aliases: CAP-23, CAP23, NAP-22, NAP22
• Gene name: brain abundant membrane attached signal protein 1
• Alternate names: brain acid soluble protein 1, 22 kDa neuronal tissue-enriched acidic protein, brain acid-soluble protein 1, neuronal axonal membrane protein NAP-22, neuronal tissue-enriched acidic protein,
• Gene location: 5p15.1 (17216822: 17276844)     Exons: 3     NC_000005.10
• Gene summary(Entrez): This gene encodes a membrane bound protein with several transient phosphorylation sites and PEST motifs. Conservation of proteins with PEST sequences among different species supports their functional significance. PEST sequences typically occur in protein
• OMIM: 605940

Protein Summary

• Protein general information: P80723  
  • Name: Brain acid soluble protein 1 (22 kDa neuronal tissue enriched acidic protein) (Neuronal axonal membrane protein NAP 22)
  • Length: 227  
  • Mass: 22693
  • Tissue specificity: Brain.
• Sequence:

  MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQDAEGKAEEKEGEKDA
  AAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAPKAAEAAAAPAESAAPAAGEEPSKEEGEPKK
  TEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTV
  KE

• Structural information:
  • Interpro: IPR008408  
  • STRING: ENSP00000319281
• Other Databases: GeneCards:  BASP1  Malacards:  BASP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008180	COP9 signalosome	IDA	colocalizes with
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0072112	glomerular visceral epithelial cell differentiation	IEA	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000785	chromatin	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0021762	substantia nigra development	HEP	biological process
GO:0016605	PML body	IDA	cellular component
GO:0016363	nuclear matrix	IDA	cellular component
GO:2001076	positive regulation of metanephric ureteric bud development	ISS	biological process
GO:0072112	glomerular visceral epithelial cell differentiation	ISS	biological process
GO:0072112	glomerular visceral epithelial cell differentiation	ISS	biological process
GO:0060421	positive regulation of heart growth	ISS	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0008406	gonad development	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0060539	diaphragm development	ISS	biological process
GO:0060231	mesenchymal to epithelial transition	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0072075	metanephric mesenchyme development	ISS	biological process
GO:0016607	nuclear speck	ISS	cellular component
GO:0007356	thorax and anterior abdomen determination	ISS	biological process
GO:0003714	transcription corepressor activity	IMP	molecular function
GO:0031982	vesicle	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881