• Gene id: 10406

Gene Summary

• Gene Symbol: WFDC2   Gene   UCSC   Ensembl
• Aliases: EDDM4, HE4, WAP5, dJ461P17.6
• Gene name: WAP four-disulfide core domain 2
• Alternate names: WAP four-disulfide core domain protein 2, WAP domain containing protein HE4-V4, epididymal protein 4, epididymal secretory protein E4, epididymis secretory sperm binding protein, epididymis-specific, whey-acidic protein type, four-disulfide core, major epididym,
• Gene location: 20q13.12 (45469752: 45481531)     Exons: 4     NC_000020.11
• Gene summary(Entrez): This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members
• OMIM: 604784

Protein Summary

• Protein general information: Q14508  
  • Name: WAP four disulfide core domain protein 2 (Epididymal secretory protein E4) (Major epididymis specific protein E4) (Putative protease inhibitor WAP5)
  • Length: 124  
  • Mass: 12993
  • Tissue specificity: Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines.
• Sequence:

  MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPND
  KEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

• Structural information:
  • Protein Domains: (31..7-)
    (/note="WAP-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00722-)
    (74..12-)
    (/note="WAP-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00722"-)
  • Interpro: IPR036645  IPR008197  
  • Prosite: PS51390
  • STRING: ENSP00000361761
• Other Databases: GeneCards:  WFDC2  Malacards:  WFDC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019828	aspartic-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0019731	antibacterial humoral response	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0019828	aspartic-type endopeptidase inhibitor activity	IEA	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0004866	endopeptidase inhibitor activity	TAS	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881