• Gene id: 10404

Gene Summary

• Gene Symbol: CPQ   Gene   UCSC   Ensembl
• Aliases: LDP, PGCP
• Gene name: carboxypeptidase Q
• Alternate names: carboxypeptidase Q, Ser-Met dipeptidase, aminopeptidase, blood plasma glutamate carboxypeptidase, lysosomal dipeptidase,
• Gene location: 8q22.1 (96645241: 97143500)     Exons: 8     NC_000008.11
• Gene summary(Entrez): This gene encodes a metallopeptidase that belongs to the peptidase M28 family. The encoded protein may catalyze the cleavage of dipeptides with unsubstituted terminals into amino acids. [provided by RefSeq, Jul 2013]
• OMIM: 618754

Protein Summary

• Protein general information: Q9Y646  
  • Name: Carboxypeptidase Q (EC 3.4.17. ) (Lysosomal dipeptidase) (Plasma glutamate carboxypeptidase)
  • Length: 472  
  • Mass: 51888
  • Tissue specificity: Mainly detected in blood plasma. Abundant in placenta and kidney. Present at low level in muscles, liver and skin fibroblasts. Not detected in brain or white blood cells (at protein level). {ECO
• Sequence:

  MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVDTVG
  PRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPEGITAEV
  LVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDG
  VPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGA
  MDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHKVNISNYSLVMESDAGTFLPTGLQF
  TGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGASLLDDLYKYFFFHHSHGDTMTVMDPKQMNV
  AAAVWAVVSYVVADMEEMLPRS

• Structural information:
  • Interpro: IPR039866  IPR007484  
  • STRING: ENSP00000220763
• Other Databases: GeneCards:  CPQ  Malacards:  CPQ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070573	metallodipeptidase activity	IEA	molecular function
GO:0070573	metallodipeptidase activity	IBA	molecular function
GO:0006508	proteolysis	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0043171	peptide catabolic process	IBA	biological process
GO:0006590	thyroid hormone generation	IBA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0042246	tissue regeneration	IEA	biological process
GO:0006590	thyroid hormone generation	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0070573	metallodipeptidase activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0043171	peptide catabolic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005764	lysosome	ISS	cellular component
GO:0042246	tissue regeneration	ISS	biological process
GO:0006590	thyroid hormone generation	ISS	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray