Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 10403
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol NDC80   Gene   UCSC   Ensembl
Aliases HEC, HEC1, HsHec1, KNTC2, TID3, hsNDC80
Gene name NDC80 kinetochore complex component
Alternate names kinetochore protein NDC80 homolog, NDC80 homolog, kinetochore complex component, NDC80 kinetochore complex component homolog, highly expressed in cancer protein, highly expressed in cancer, rich in leucine heptad repeats, kinetochore associated 2, kinetochore p,
Gene location 18p11.32 (2571556: 2616634)     Exons: 17     NC_000018.10
Gene summary(Entrez) This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to o
OMIM 607272

Protein Summary
Protein general information O14777  

Name: Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore associated protein 2) (Retinoblastoma associated protein HEC)

Length: 642  Mass: 73913

Sequence MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQLGIFS
SSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSYELPDTKFEEE
VPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLF
LDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLK
ASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENTRLQNIIDNQKYSVADIERINHERNE
LQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANCL
VKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEED
EKCASELESLEKHKHLLESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHL
EEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE
Structural information
Interpro:  IPR040967  IPR005550  IPR038273  

PDB:  		 2IGP 2VE7 3IZ0
PDBsum:   2IGP 2VE7 3IZ0

DIP:  
35100
MINT:  
STRING:   ENSP00000261597
Other Databases GeneCards:  NDC80  Malacards:  NDC80

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0000778 condensed nuclear chromos
ome kinetochore
 IBA cellular component
GO:0031262 Ndc80 complex
 IBA cellular component
GO:0051315 attachment of mitotic spi
ndle microtubules to kine
tochore
 IBA biological process
GO:0000776 kinetochore
 IDA cellular component
GO:0000776 kinetochore
 IDA cellular component
GO:0031262 Ndc80 complex
 IDA cellular component
GO:0000777 condensed chromosome kine
tochore
 IDA cellular component
GO:0090267 positive regulation of mi
totic cell cycle spindle
assembly checkpoint
 IMP biological process
GO:0007052 mitotic spindle organizat
ion
 IMP biological process
GO:0000132 establishment of mitotic
spindle orientation
 IMP biological process
GO:0051315 attachment of mitotic spi
ndle microtubules to kine
tochore
 IMP biological process
GO:0051310 metaphase plate congressi
on
 IMP biological process
GO:0051315 attachment of mitotic spi
ndle microtubules to kine
tochore
 IMP biological process
GO:0008608 attachment of spindle mic
rotubules to kinetochore
 IMP biological process
GO:0007059 chromosome segregation
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0031262 Ndc80 complex
 IEA cellular component
GO:0051315 attachment of mitotic spi
ndle microtubules to kine
tochore
 IEA biological process
GO:0000776 kinetochore
 IEA cellular component
GO:0051301 cell division
 IEA biological process
GO:0007049 cell cycle
 IEA biological process
GO:0000775 chromosome, centromeric r
egion
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005694 chromosome
 IEA cellular component
GO:0000278 mitotic cell cycle
 TAS biological process
GO:0000070 mitotic sister chromatid
segregation
 TAS biological process
GO:0000775 chromosome, centromeric r
egion
 TAS cellular component
GO:0005634 nucleus
 TAS cellular component
GO:0051298 centrosome duplication
 IDA biological process
GO:0051310 metaphase plate congressi
on
 IDA biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000942 condensed nuclear chromos
ome outer kinetochore
 IDA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0000777 condensed chromosome kine
tochore
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005813 centrosome
 IDA cellular component
GO:1905342 positive regulation of pr
otein localization to kin
etochore
 IMP biological process
GO:0051383 kinetochore organization
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0016020 membrane
 HDA cellular component

Diseases

Expand All | Collapse All
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract