• Gene id: 10402

Gene Summary

• Gene Symbol: ST3GAL6   Gene   UCSC   Ensembl
• Aliases: SIAT10, ST3GALVI
• Gene name: ST3 beta-galactoside alpha-2,3-sialyltransferase 6
• Alternate names: type 2 lactosamine alpha-2,3-sialyltransferase, CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI, alpha2,3-sialyltransferase ST3Gal VI, sialyltransferase 10 (alpha-2,3-sialyltransferase VI),
• Gene location: 3q12.1 (98732235: 98795844)     Exons: 16     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the sialyltransferase family. Members of this family are enzymes that transfer sialic acid from the activated cytidine 5'-monophospho-N-acetylneuraminic acid to terminal positions on sialylated glycolipids (
• OMIM: 603946

Protein Summary

• Protein general information: Q9Y274  
  • Name: Type 2 lactosamine alpha 2,3 sialyltransferase (EC 2.4.99. ) (CMP NeuAc:beta galactoside alpha 2,3 sialyltransferase VI) (ST3Gal VI) (ST3GalVI) (Sialyltransferase 10)
  • Length: 331  
  • Mass: 38214
  • Tissue specificity: Ubiquitous.
• Sequence:

  MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASL
  YGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPV
  LGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQ
  IRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSL
  MNKNAYHNVTAEQLFLKDIIEKNLVINLTQD

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • STRING: ENSP00000480884
• Other Databases: GeneCards:  ST3GAL6  Malacards:  ST3GAL6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006486	protein glycosylation	IBA	biological process
GO:0009247	glycolipid biosynthetic process	IBA	biological process
GO:0052798	beta-galactoside alpha-2,3-sialyltransferase activity	IBA	molecular function
GO:0008373	sialyltransferase activity	IBA	molecular function
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0018146	keratan sulfate biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0006664	glycolipid metabolic process	IDA	biological process
GO:0052798	beta-galactoside alpha-2,3-sialyltransferase activity	IDA	molecular function
GO:0006464	cellular protein modification process	IDA	biological process
GO:0009311	oligosaccharide metabolic process	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0071354	cellular response to interleukin-6	IEP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00601	Glycosphingolipid biosynthesis - lacto and neolacto series

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray