• Gene id: 10401

Gene Summary

• Gene Symbol: PIAS3   Gene   UCSC   Ensembl
• Aliases: ZMIZ5
• Gene name: protein inhibitor of activated STAT 3
• Alternate names: E3 SUMO-protein ligase PIAS3, E3 SUMO-protein transferase PIAS3, protein inhibitor of activated STAT protein 3, zinc finger, MIZ-type containing 5,
• Gene location: 1q21.1 (145859080: 145848521)     Exons: 14     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes
• OMIM: 605918

Protein Summary

• Protein general information: Q9Y6X2  
  • Name: E3 SUMO protein ligase PIAS3 (EC 2.3.2. ) (E3 SUMO protein transferase PIAS3) (Protein inhibitor of activated STAT protein 3)
  • Length: 628  
  • Mass: 68017
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDL
  SLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFYEVYGELIRPTTLAST
  SSQRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGY
  LPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
  RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPY
  ESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSPVQGGDPSENKKKVEVIDL
  TIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGAD
  IQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPG
  GALREGHGGPLPSGPSLTGCRSDIISLD

• Structural information:
  • Protein Domains: (11..4-)
    (/note="SAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00186-)
    (115..28-)
    (/note="PINIT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00799"-)
  • Interpro: IPR023321  IPR038654  IPR003034  IPR036361  IPR004181   IPR013083  
  • Prosite: PS51466 PS50800 PS51044
  • PDB: 4MVT
  • PDBsum: 4MVT
  • DIP: 5969
  • STRING: ENSP00000376765
• Other Databases: GeneCards:  PIAS3  Malacards:  PIAS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001085	RNA polymerase II transcription factor binding	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0061665	SUMO ligase activity	IBA	molecular function
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016925	protein sumoylation	IBA	biological process
GO:0033235	positive regulation of protein sumoylation	IDA	biological process
GO:0033234	negative regulation of protein sumoylation	IDA	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0016925	protein sumoylation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0019789	SUMO transferase activity	EXP	molecular function
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045838	positive regulation of membrane potential	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0071847	TNFSF11-mediated signaling pathway	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045671	negative regulation of osteoclast differentiation	IEA	biological process
GO:0019789	SUMO transferase activity	IEA	molecular function
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0015459	potassium channel regulator activity	IEA	molecular function
GO:0009725	response to hormone	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016925	protein sumoylation	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016925	protein sumoylation	IEA	biological process
GO:0033235	positive regulation of protein sumoylation	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq