• Gene id: 10397

Gene Summary

• Gene Symbol: NDRG1   Gene   UCSC   Ensembl
• Aliases: CAP43, CMT4D, DRG-1, DRG1, GC4, HMSNL, NDR1, NMSL, PROXY1, RIT42, RTP, TARG1, TDD5
• Gene name: N-myc downstream regulated 1
• Alternate names: protein NDRG1, N-myc downstream-regulated gene 1 protein, differentiation-related gene 1 protein, nickel-specific induction protein Cap43, protein regulated by oxygen-1, reducing agents and tunicamycin-responsive protein,
• Gene location: 8q24.22 (133297251: 133237174)     Exons: 18     NC_000008.11
• Gene summary(Entrez): This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation
• OMIM: 603246

Protein Summary

• Protein general information: Q92597  
  • Name: Protein NDRG1 (Differentiation related gene 1 protein) (DRG 1) (N myc downstream regulated gene 1 protein) (Nickel specific induction protein Cap43) (Reducing agents and tunicamycin responsive protein) (RTP) (Rit42)
  • Length: 394  
  • Mass: 42835
  • Tissue specificity: Ubiquitous; expressed most prominently in placental membranes and prostate, kidney, small intestine, and ovary tissues. Also expressed in heart, brain, skeletal muscle, lung, liver and pancreas. Low levels in peripheral blood leukocyte
• Sequence:

  MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNP
  LFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFA
  LNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLH
  LFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAK
  LAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDIT
  PNSGAAGNSAGPKSMEVSC

• Structural information:
  • Interpro: IPR029058  IPR004142  IPR030693  
  • STRING: ENSP00000404854
• Other Databases: GeneCards:  NDRG1  Malacards:  NDRG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0045296	cadherin binding	IDA	molecular function
GO:0017137	Rab GTPase binding	IDA	molecular function
GO:0008017	microtubule binding	IDA	molecular function
GO:0005912	adherens junction	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0043015	gamma-tubulin binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0030330	DNA damage response, signal transduction by p53 class mediator	IEP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0032287	peripheral nervous system myelin maintenance	IEA	biological process
GO:0045576	mast cell activation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0010038	response to metal ion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0099173	postsynapse organization	IEA	biological process
GO:0045576	mast cell activation	IEA	biological process
GO:0032287	peripheral nervous system myelin maintenance	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0071456	cellular response to hypoxia	IEP	biological process

Diseases

Associated diseases	References
Charcot-Marie-Tooth disease	KEGG:H00264
Charcot-Marie-Tooth disease	KEGG:H00264
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq