• Gene id: 10391

Gene Summary

• Gene Symbol: CORO2B   Gene   UCSC   Ensembl
• Aliases: CLIPINC
• Gene name: coronin 2B
• Alternate names: coronin-2B, clipin C, coronin, actin binding protein, 2B, coronin-like protein C,
• Gene location: 15q23 (68518372: 68727805)     Exons: 17     NC_000015.10
• OMIM: 603397

Protein Summary

• Protein general information: Q9UQ03  
  • Name: Coronin 2B (Coronin like protein C) (Clipin C) (Protein FC96)
  • Length: 480  
  • Mass: 54953
  • Tissue specificity: Expressed predominantly in brain.
• Sequence:

  MTVTKMSWRPQYRSSKFRNVYGKVANREHCFDGIPITKNVHDNHFCAVNTRFLAIVTESAGGGSFLVIPLEQTGR
  IEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEGGLKRNMTEALLELHGHSRRVGLVEWHPTTN
  NILFSAGYDYKVLIWNLDVGEPVKMIDCHTDVILCMSFNTDGSLLTTTCKDKKLRVIEPRSGRVLQEANCKNHRV
  NRVVFLGNMKRLLTTGVSRWNTRQIALWDQEDLSMPLIEEEIDGLSGLLFPFYDADTHMLYLAGKGDGNIRYYEI
  STEKPYLSYLMEFRSPAPQKGLGVMPKHGLDVSACEVFRFYKLVTLKGLIEPISMIVPRRSDSYQEDIYPMTPGT
  EPALTPDEWLGGINRDPVLMSLKEGYKKSSKMVFKAPIKEKKSVVVNGIDLLENVPPRTENELLRMFFRQQDEIR
  RLKEELAQKDIRIRQLQLELKNLRNSPKNC

• Structural information:
  • Interpro: IPR027339  IPR015505  IPR015048  IPR015943  IPR001680   IPR019775  IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000454783
• Other Databases: GeneCards:  CORO2B  Malacards:  CORO2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051015	actin filament binding	IBA	molecular function
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:1904950	negative regulation of establishment of protein localization	IDA	biological process
GO:1990147	talin binding	IDA	molecular function
GO:1904951	positive regulation of establishment of protein localization	IDA	biological process
GO:0080135	regulation of cellular response to stress	IDA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IDA	biological process
GO:0010812	negative regulation of cell-substrate adhesion	IDA	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0017166	vinculin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048041	focal adhesion assembly	IEA	biological process
GO:0003093	regulation of glomerular filtration	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0051497	negative regulation of stress fiber assembly	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	NAS	cellular component
GO:0030036	actin cytoskeleton organization	NAS	biological process
GO:0003779	actin binding	NAS	molecular function
GO:0015629	actin cytoskeleton	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq