• Gene id: 10365

Gene Summary

• Gene Symbol: KLF2   Gene   UCSC   Ensembl
• Aliases: LKLF
• Gene name: Kruppel like factor 2
• Alternate names: Krueppel-like factor 2, Kruppel-like factor 2 (lung), Kruppel-like factor LKLF, lung Kruppel-like factor, lung Kruppel-like zinc finger transcription factor, lung krueppel-like factor,
• Gene location: 19p13.11 (16324825: 16328684)     Exons: 3     NC_000019.10
• Gene summary(Entrez): This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is expressed early in mammalian development and is found in many different cell types. The protein acts to bind the CACCC box found in
• OMIM: 605980

Protein Summary

• Protein general information: Q9Y5W3  
  • Name: Krueppel like factor 2 (Lung krueppel like factor)
  • Length: 355  
  • Mass: 37420
• Sequence:

  MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEAAPEPPPPPPPPAFYY
  PEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGLTRGPRGLKRE
  GAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDA
  AAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEK
  PYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • DIP: 41973
  • STRING: ENSP00000248071
• Other Databases: GeneCards:  KLF2  Malacards:  KLF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0048386	positive regulation of retinoic acid receptor signaling pathway	IDA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0043249	erythrocyte maturation	IEA	biological process
GO:0040029	regulation of gene expression, epigenetic	IEA	biological process
GO:0034101	erythrocyte homeostasis	IEA	biological process
GO:0000902	cell morphogenesis	IEA	biological process
GO:0071409	cellular response to cycloheximide	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0060509	type I pneumocyte differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0001701	in utero embryonic development	IEA	biological process
GO:1901653	cellular response to peptide	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0034616	response to laminar fluid shear stress	IEA	biological process
GO:0032715	negative regulation of interleukin-6 production	IEA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IDA	biological process
GO:0097533	cellular stress response to acid chemical	IMP	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	molecular function
GO:0003677	DNA binding	IMP	molecular function
GO:0036003	positive regulation of transcription from RNA polymerase II promoter in response to stress	IMP	biological process
GO:0051247	positive regulation of protein metabolic process	IGI	biological process
GO:0071499	cellular response to laminar fluid shear stress	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:1903671	negative regulation of sprouting angiogenesis	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0071498	cellular response to fluid shear stress	IMP	biological process
GO:0000790	nuclear chromatin	IMP	cellular component
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04371	Apelin signaling pathway
hsa05418	Fluid shear stress and atherosclerosis
hsa04068	FoxO signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospadias	MIK: 24778562
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
24778562	Hypospadias			13 (5 controls, 8 cases)	Male infertility	Microarray