• Gene id: 10360

Gene Summary

• Gene Symbol: NPM3   Gene   UCSC   Ensembl
• Aliases: PORMIN, TMEM123
• Gene name: nucleophosmin/nucleoplasmin 3
• Alternate names: nucleoplasmin-3, nucleophosmin/nucleoplasmin family, member 3,
• Gene location: 10q24.32 (101783412: 101781324)     Exons: 6     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleop
• OMIM: 602822

Protein Summary

• Protein general information: O75607  
  • Name: Nucleoplasmin 3
  • Length: 178  
  • Mass: 19344
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGA
  KDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEE
  SEEEEEDSDEEEVELCPILPAKKQGGRP

• Structural information:
  • Interpro: IPR004301  IPR024057  IPR036824  
  • STRING: ENSP00000359128
• Other Databases: GeneCards:  NPM3  Malacards:  NPM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006338	chromatin remodeling	IBA	biological process
GO:0003682	chromatin binding	IBA	molecular function
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005730	nucleolus	IBA	cellular component
GO:0042393	histone binding	IBA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009303	rRNA transcription	IEA	biological process
GO:0006364	rRNA processing	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881