• Gene id: 1036

Gene Summary

• Gene Symbol: CDO1   Gene   UCSC   Ensembl
• Aliases: CDO-I
• Gene name: cysteine dioxygenase type 1
• Alternate names: cysteine dioxygenase type 1, cysteine dioxygenase, type I,
• Gene location: 5q22.3 (115816658: 115804732)     Exons: 8     NC_000005.10
• OMIM: 603943

SNPs

rs8191246

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.82098435A>G
NC_000016.9   g.82132040A>G
NM_002153.3   c.1163A>G
NM_002153.2   c.1163A>G
XR_001751898.2   n.1381A>G
NP_002144.1   p.Ter388Trp|SEQ=[A/G]|GENE=HSD17B2

Protein Summary

• Protein general information: Q16878  
  • Name: Cysteine dioxygenase type 1 (EC 1.13.11.20) (Cysteine dioxygenase type I) (CDO) (CDO I)
  • Length: 200  
  • Mass: 22972
  • Tissue specificity: Highly expressed in liver and placenta. Low expression in heart, brain and pancreas. Also detected in hepatoblastoma Hep-G2 cells. {ECO
• Sequence:

  MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMIL
  CWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEP
  AVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN

• Structural information:
  • Interpro: IPR010300  IPR014710  IPR011051  
  • PDB: 2IC1 6BGF 6BGM 6BPR 6BPS 6BPT 6BPU 6BPV 6BPW 6BPX 6CDH 6CDN 6E87 6N42 6N43
  • PDBsum: 2IC1 6BGF 6BGM 6BPR 6BPS 6BPT 6BPU 6BPV 6BPW 6BPX 6CDH 6CDN 6E87 6N42 6N43
  • STRING: ENSP00000250535
• Other Databases: GeneCards:  CDO1  Malacards:  CDO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008198	ferrous iron binding	IBA	molecular function
GO:0017172	cysteine dioxygenase activity	IBA	molecular function
GO:0019448	L-cysteine catabolic process	IBA	biological process
GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IBA	molecular function
GO:0005506	iron ion binding	IEA	molecular function
GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0017172	cysteine dioxygenase activity	IEA	molecular function
GO:0019448	L-cysteine catabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0007595	lactation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0051591	response to cAMP	IEA	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0033762	response to glucagon	IEA	biological process
GO:0019448	L-cysteine catabolic process	IEA	biological process
GO:0017172	cysteine dioxygenase activity	IEA	molecular function
GO:0008198	ferrous iron binding	IEA	molecular function
GO:0042412	taurine biosynthetic process	IEA	biological process
GO:0006534	cysteine metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042412	taurine biosynthetic process	TAS	biological process
GO:0017172	cysteine dioxygenase activity	ISS	molecular function
GO:0000097	sulfur amino acid biosynthetic process	TAS	biological process
GO:0055114	oxidation-reduction process	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00270	Cysteine and methionine metabolism
hsa00430	Taurine and hypotaurine metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881