• Gene id: 10346

Gene Summary

• Gene Symbol: TRIM22   Gene   UCSC   Ensembl
• Aliases: GPSTAF50, RNF94, STAF50
• Gene name: tripartite motif containing 22
• Alternate names: E3 ubiquitin-protein ligase TRIM22, 50 kDa-stimulated trans-acting factor, RING finger protein 94, RING-type E3 ubiquitin transferase TRIM22, staf-50, stimulated trans-acting factor (50 kDa), tripartite binding motif 22, tripartite motif protein TRIM22, tripartit,
• Gene location: 11p15.4 (5689789: 5710862)     Exons: 8     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the cytoplasm and its ex
• OMIM: 604473

Protein Summary

• Protein general information: Q8IYM9  
  • Name: E3 ubiquitin protein ligase TRIM22 (EC 2.3.2.27) (50 kDa stimulated trans acting factor) (RING finger protein 94) (RING type E3 ubiquitin transferase TRIM22) (Staf 50) (Tripartite motif containing protein 22)
  • Length: 498  
  • Mass: 56947
  • Tissue specificity: Strongly expressed in peripheral blood leukocytes, spleen, thymus, and ovary. Expressed at basal levels in other tissues. {ECO
• Sequence:

  MDFSVKVDIEKEVTCPICLELLTEPLSLDCGHSFCQACITAKIKESVIISRGESSCPVCQTRFQPGNLRPNRHLA
  NIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCELSQEHQGHQTFRINEVVKECQEKLQVALQR
  LIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQ
  QRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRVPDLSGMLQVLKELTDVQYYW
  VDVMLNPGSATSNVAISVDQRQVKTVRTCTFKNSNPCDFSAFGVFGCQYFSSGKYYWEVDVSGKIAWILGVHSKI
  SSLNKRKSSGFAFDPSVNYSKVYSRYRPQYGYWVIGLQNTCEYNAFEDSSSSDPKVLTLFMAVPPCRIGVFLDYE
  AGIVSFFNVTNHGALIYKFSGCRFSRPAYPYFNPWNCLVPMTVCPPSS

• Structural information:
  • Protein Domains: (283..49-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR035827  IPR003877   IPR027370  IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS50119 PS00518 PS50089
  • CDD: cd00021 cd15824
  • STRING: ENSP00000369299
• Other Databases: GeneCards:  TRIM22  Malacards:  TRIM22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0046596	regulation of viral entry into host cell	IBA	biological process
GO:0032880	regulation of protein localization	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0016567	protein ubiquitination	IBA	biological process
GO:0010508	positive regulation of autophagy	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0009615	response to virus	TAS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0015030	Cajal body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032880	regulation of protein localization	IMP	biological process
GO:0030674	protein-macromolecule adaptor activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R