• Gene id: 10345

Gene Summary

• Gene Symbol: TRDN   Gene   UCSC   Ensembl
• Aliases: CPVT5, TDN, TRISK
• Gene name: triadin
• Alternate names: triadin, triadin in skeletal muscle,
• Gene location: 6q22.31 (75426691: 75474106)     Exons: 12     NC_000014.9
• Gene summary(Entrez): This gene encodes an integral membrane protein that contains a single transmembrane domain. As similar protein in rabbits plays a role in skeletal muscle excitation-contraction coupling as part of the calcium release complex in association with the ryanod
• OMIM: 603283

Protein Summary

• Protein general information: Q13061  
  • Name: Triadin
  • Length: 729  
  • Mass: 81595
• Sequence:

  MTEITAEGNASTTTTVIDSKNGSVPKSPGKVLKRTVTEDIVTTFSSPAAWLLVIALIITWSAVAIVMFDLVDYKN
  FSASSIAKIGSDPLKLVRDAMEETTDWIYGFFSLLSDIISSEDEEDDDGDEDTDKGEIDEPPLRKKEIHKDKTEK
  QEKPERKIQTKVTHKEKEKGKEKVREKEKPEKKATHKEKIEKKEKPETKTLAKEQKKAKTAEKSEEKTKKEVKGG
  KQEKVKQTAAKVKEVQKTPSKPKEKEDKEKAAVSKHEQKDQYAFCRYMIDIFVHGDLKPGQSPAIPPPLPTEQAS
  RPTPASPALEEKEGEKKKAEKKVTSETKKKEKEDIKKKSEKETAIDVEKKEPGKASETKQGTVKIAAQAAAKKDE
  KKEDSKKTKKPAEVEQPKGKKQEKKEKHVEPAKSPKKEHSVPSDKQVKAKTERAKEEIGAVSIKKAVPGKKEEKT
  TKTVEQEIRKEKSGKTSSILKDKEPIKGKEEKVPASLKEKEPETKKDEKMSKAGKEVKPKPPQLQGKKEEKPEPQ
  IKKEAKPAISEKVQIHKQDIVKPEKTVSHGKPEEKVLKQVKAVTIEKTAKPKPTKKAEHREREPPSIKTDKPKPT
  PKGTSEVTESGKKKTEISEKESKEKADMKHLREEKVSTRKESLQLHNVTKAEKPARVSKDVEDVPASKKAKEGTE
  DVSPTKQKSPISFFQCVYLDGYNGYGFQFPFTPADRPGESSGQANSPGQKQQGQ

• Structural information:
  • Interpro: IPR007943  IPR010798  
  • STRING: ENSP00000439281
• Other Databases: GeneCards:  TRDN  Malacards:  TRDN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060316	positive regulation of ryanodine-sensitive calcium-release channel activity	IBA	biological process
GO:0044325	ion channel binding	IBA	molecular function
GO:0010880	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IBA	biological process
GO:0086036	regulation of cardiac muscle cell membrane potential	IBA	biological process
GO:0060047	heart contraction	IBA	biological process
GO:0014701	junctional sarcoplasmic reticulum membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006936	muscle contraction	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0033018	sarcoplasmic reticulum lumen	TAS	cellular component
GO:1903779	regulation of cardiac conduction	TAS	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0014808	release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IEA	biological process
GO:0060047	heart contraction	IEA	biological process
GO:0044325	ion channel binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030674	protein-macromolecule adaptor activity	ISS	molecular function
GO:0006874	cellular calcium ion homeostasis	ISS	biological process
GO:0010880	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	ISS	biological process
GO:0016529	sarcoplasmic reticulum	ISS	cellular component
GO:0033018	sarcoplasmic reticulum lumen	TAS	cellular component
GO:0060316	positive regulation of ryanodine-sensitive calcium-release channel activity	ISS	biological process
GO:0060316	positive regulation of ryanodine-sensitive calcium-release channel activity	TAS	biological process
GO:0010649	regulation of cell communication by electrical coupling	TAS	biological process
GO:0014701	junctional sarcoplasmic reticulum membrane	TAS	cellular component
GO:0014808	release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	ISS	biological process
GO:0033017	sarcoplasmic reticulum membrane	TAS	cellular component
GO:0051279	regulation of release of sequestered calcium ion into cytosol	TAS	biological process
GO:0060047	heart contraction	IMP	biological process
GO:0060315	negative regulation of ryanodine-sensitive calcium-release channel activity	TAS	biological process
GO:0086036	regulation of cardiac muscle cell membrane potential	ISS	biological process
GO:1901846	positive regulation of cell communication by electrical coupling involved in cardiac conduction	ISS	biological process
GO:0031122	cytoplasmic microtubule organization	ISS	biological process
GO:0090158	endoplasmic reticulum membrane organization	ISS	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0030314	junctional membrane complex	ISS	cellular component
GO:0014701	junctional sarcoplasmic reticulum membrane	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04020	Calcium signaling pathway
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Catecholaminergic polymorphic ventricular tachycardia	KEGG:H01019
Catecholaminergic polymorphic ventricular tachycardia	KEGG:H01019
Catecholaminergic polymorphic ventricular tachycardia	PMID:22422768
Cardiomyopathy	PMID:17400717
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq