• Gene id: 10344

Gene Summary

• Gene Symbol: CCL26   Gene   UCSC   Ensembl
• Aliases: IMAC, MIP-4a, MIP-4alpha, SCYA26, TSC-1
• Gene name: C-C motif chemokine ligand 26
• Alternate names: C-C motif chemokine 26, CC chemokine IMAC, MIP-4-alpha, chemokine (C-C motif) ligand 26, chemokine N1, eotaxin-3, macrophage inflammatory protein 4-alpha, small inducible cytokine A26, small inducible cytokine subfamily A (Cys-Cys), member 26, thymic stroma chemok,
• Gene location: 7q11.23 (75791596: 75769523)     Exons: 5     NC_000007.14
• Gene summary(Entrez): This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cy
• OMIM: 604697

Protein Summary

• Protein general information: Q9Y258  
  • Name: C C motif chemokine 26 (CC chemokine IMAC) (Eotaxin 3) (Macrophage inflammatory protein 4 alpha) (MIP 4 alpha) (Small inducible cytokine A26) (Thymic stroma chemokine 1) (TSC 1)
  • Length: 94  
  • Mass: 10648
  • Tissue specificity: Ubiquitously expressed at low levels in various tissues including heart and ovary. {ECO
• Sequence:

  MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTH
  PRKKWVQKYISLLKTPKQL

• Structural information:
  • Interpro: IPR039809  IPR000827  IPR001811  IPR036048  
  • Prosite: PS00472
  • PDB: 1G2S 1G2T
  • PDBsum: 1G2S 1G2T
  • DIP: 5877
  • STRING: ENSP00000378365
• Other Databases: GeneCards:  CCL26  Malacards:  CCL26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0008009	chemokine activity	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0030838	positive regulation of actin filament polymerization	IDA	biological process
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0002548	monocyte chemotaxis	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IDA	biological process
GO:0050921	positive regulation of chemotaxis	IDA	biological process
GO:0008009	chemokine activity	IDA	molecular function
GO:0010818	T cell chemotaxis	IDA	biological process
GO:0031728	CCR3 chemokine receptor binding	IDA	molecular function
GO:0048018	receptor ligand activity	IDA	molecular function
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Allergic rhinitis	KEGG:H01360
Eosinophilic esophagitis	KEGG:H01361
Allergic rhinitis	KEGG:H01360
Cutaneous T cell lymphoma	PMID:20505746
Asthma	PMID:16304252
Asthma	PMID:18712274
Churg-Strauss syndrome	PMID:21266446
Atopic dermatitis	PMID:14616792
Coronary artery disease	PMID:16620281
Bullous pemphigoid	PMID:21881593
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881