About Us

Search Result


Gene id 10342
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol TFG   Gene   UCSC   Ensembl
Aliases HMSNP, SPG57, TF6, TRKT3
Gene name trafficking from ER to golgi regulator
Alternate names protein TFG, TRK-fused, TRK-fused gene protein, TRKT3 oncogene,
Gene location 3q12.2 (68898816: 68956311)     Exons: 20     NC_000010.11
Gene summary(Entrez) There are several documented fusion oncoproteins encoded partially by this gene. This gene also participates in several oncogenic rearrangements resulting in anaplastic lymphoma and mixoid chondrosarcoma, and may play a role in the NF-kappaB pathway. Mult
OMIM 602498

Protein Summary

Protein general information Q92734  

Name: Protein TFG (TRK fused gene protein)

Length: 400  Mass: 43448

Tissue specificity: Ubiquitous.

Sequence MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLS
FAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSAS
DSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQ
QPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAP
APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPP
SGPNPYARNRPPFGQGYTQPGPGYR
Structural information
Protein Domains
(10..9-)
(/note="PB1-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU01081"-)
Interpro:  IPR000270  IPR034857  IPR033512  
Prosite:   PS51745
CDD:   cd06401
MINT:  
STRING:   ENSP00000240851
Other Databases GeneCards:  TFG  Malacards:  TFG

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0070971 endoplasmic reticulum exi
t site
IBA cellular component
GO:0006888 endoplasmic reticulum to
Golgi vesicle-mediated tr
ansport
IBA biological process
GO:0070971 endoplasmic reticulum exi
t site
IDA cellular component
GO:0070971 endoplasmic reticulum exi
t site
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0006888 endoplasmic reticulum to
Golgi vesicle-mediated tr
ansport
IMP biological process
GO:0005515 protein binding
IPI molecular function
GO:0006888 endoplasmic reticulum to
Golgi vesicle-mediated tr
ansport
IMP biological process
GO:0048208 COPII vesicle coating
IEA biological process
GO:0006888 endoplasmic reticulum to
Golgi vesicle-mediated tr
ansport
IEA biological process
GO:0042802 identical protein binding
IEA molecular function
GO:0016192 vesicle-mediated transpor
t
IEA biological process
GO:0005783 endoplasmic reticulum
IEA cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0048208 COPII vesicle coating
TAS biological process
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005783 endoplasmic reticulum
IEA cellular component
GO:0043231 intracellular membrane-bo
unded organelle
IDA cellular component
GO:0005829 cytosol
IDA cellular component
GO:0000139 Golgi membrane
IEA cellular component
GO:0000139 Golgi membrane
IEA cellular component
GO:0005737 cytoplasm
NAS cellular component
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
HMP biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05200Pathways in cancer
hsa05216Thyroid cancer
Associated diseases References
Hereditary spastic paraplegia KEGG:H00266
Thyroid cancer KEGG:H00032
Hereditary spastic paraplegia KEGG:H00266
Thyroid cancer KEGG:H00032
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract