• Gene id: 10336

Gene Summary

• Gene Symbol: PCGF3   Gene   UCSC   Ensembl
• Aliases: DONG1, RNF3, RNF3A
• Gene name: polycomb group ring finger 3
• Alternate names: polycomb group RING finger protein 3, RING finger protein 3A, ring finger protein 3,
• Gene location: 4p16.3 (26538346: 26546932)     Exons: 5     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene contains a C3HC4 type RING finger, which is a motif known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. [provided by RefSeq, Jul 2008]
• OMIM: 617543

Protein Summary

• Protein general information: Q3KNV8  
  • Name: Polycomb group RING finger protein 3 (RING finger protein 3A)
  • Length: 242  
  • Mass: 28115
• Sequence:

  MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQ
  DIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHR
  SDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWR
  FKKAPLLLHYRPKMDLL

• Structural information:
  • Interpro: IPR032443  IPR001841  IPR013083  IPR017907  
  • Prosite: PS00518 PS50089
  • DIP: 52782
  • STRING: ENSP00000354724
• Other Databases: GeneCards:  PCGF3  Malacards:  PCGF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060819	inactivation of X chromosome by genetic imprinting	IBA	biological process
GO:0035102	PRC1 complex	IBA	cellular component
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0036353	histone H2A-K119 monoubiquitination	IBA	biological process
GO:0031519	PcG protein complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0031519	PcG protein complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000805	X chromosome	ISS	colocalizes with
GO:0060819	inactivation of X chromosome by genetic imprinting	ISS	biological process
GO:0036353	histone H2A-K119 monoubiquitination	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000805	X chromosome	IEA	cellular component
GO:0060819	inactivation of X chromosome by genetic imprinting	IEA	biological process
GO:0031519	PcG protein complex	IEA	cellular component
GO:0036353	histone H2A-K119 monoubiquitination	IEA	biological process
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04550	Signaling pathways regulating pluripotency of stem cells

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray