• Gene id: 10333

Gene Summary

• Gene Symbol: TLR6   Gene   UCSC   Ensembl
• Aliases: CD286
• Gene name: toll like receptor 6
• Alternate names: toll-like receptor 6,
• Gene location: 4p14 (38857766: 38823679)     Exons: 6     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func
• OMIM: 618211

Protein Summary

• Protein general information: Q9Y2C9  
  • Name: Toll like receptor 6 (EC 3.2.2.6) (CD antigen CD286)
  • Length: 796  
  • Mass: 91880
  • Tissue specificity: Detected in monocytes, CD11c+ immature dendritic cells, plasmacytoid pre-dendritic cells and dermal microvessel endothelial cells.
• Sequence:

  MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMSQNYIAELQVSDMSFL
  SELTVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPIVSFRHLDLSFNDFKALPICKEFGNLSQLNF
  LGLSAMKLQKLDLLPIAHLHLSYILLDLRNYYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQL
  TNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
  KTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNFTQNVFTDSIFEKCST
  LVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRHKENCTWVESIVVLNLSSNMLTDSVFRCLPP
  RIKVLDLHSNKIKSVPKQVVKLEALQELNVAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIK
  AGDNPFQCTCELREFVKNIDQVSSEVLEGWPDSYKCDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAV
  TVTSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSEHDSAWVKSELVPYLEKEDIQICLHE
  RNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFHEGSNNLILILLEPIPQNSIPNKYHK
  LKALMTQRTYLQWPKEKSKRGLFWANIRAAFNMKLTLVTENNDVKS

• Structural information:
  • Protein Domains: (521..57-)
    (/note="LRRCT-)
    (640..78-)
    (/note="TIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00204"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  IPR000157   IPR027187  IPR035897  
  • Prosite: PS51450 PS50104
  • PDB: 4OM7
  • PDBsum: 4OM7
  • STRING: ENSP00000389600
• Other Databases: GeneCards:  TLR6  Malacards:  TLR6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	IC	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	ISS	biological process
GO:1903223	positive regulation of oxidative stress-induced neuron death	ISS	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:1904646	cellular response to amyloid-beta	IGI	biological process
GO:2000483	negative regulation of interleukin-8 secretion	IGI	biological process
GO:1900017	positive regulation of cytokine production involved in inflammatory response	ISS	biological process
GO:0140052	cellular response to oxidised low-density lipoprotein particle stimulus	ISS	biological process
GO:1903428	positive regulation of reactive oxygen species biosynthetic process	ISS	biological process
GO:0005623	obsolete cell	IPI	cellular component
GO:0043235	receptor complex	IPI	cellular component
GO:0045429	positive regulation of nitric oxide biosynthetic process	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0043032	positive regulation of macrophage activation	ISS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	ISS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IGI	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IGI	biological process
GO:0034136	negative regulation of toll-like receptor 2 signaling pathway	IGI	biological process
GO:0002224	toll-like receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0035355	Toll-like receptor 2-Toll-like receptor 6 protein complex	IBA	cellular component
GO:0035663	Toll-like receptor 2 binding	IBA	molecular function
GO:0071221	cellular response to bacterial lipopeptide	IBA	biological process
GO:0071726	cellular response to diacyl bacterial lipopeptide	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0071723	lipopeptide binding	IBA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0071726	cellular response to diacyl bacterial lipopeptide	IDA	biological process
GO:0050702	interleukin-1 beta secretion	ISS	biological process
GO:1900227	positive regulation of NLRP3 inflammasome complex assembly	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0035663	Toll-like receptor 2 binding	IPI	molecular function
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0034150	toll-like receptor 6 signaling pathway	IEA	biological process
GO:0050707	regulation of cytokine secretion	IEA	biological process
GO:0002224	toll-like receptor signaling pathway	IEA	biological process
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042496	detection of diacyl bacterial lipopeptide	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0042742	defense response to bacterium	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0050135	NAD(P)+ nucleosidase activity	IEA	molecular function
GO:0061809	NAD+ nucleotidase, cyclic ADP-ribose generating	IEA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0071726	cellular response to diacyl bacterial lipopeptide	IDA	biological process
GO:0043507	positive regulation of JUN kinase activity	IDA	biological process
GO:0042496	detection of diacyl bacterial lipopeptide	IDA	biological process
GO:0001775	cell activation	IDA	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0038124	toll-like receptor TLR6:TLR2 signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046209	nitric oxide metabolic process	IEA	biological process
GO:0032493	response to bacterial lipoprotein	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0002224	toll-like receptor signaling pathway	IEA	biological process
GO:0001774	microglial cell activation	IEA	biological process
GO:0071723	lipopeptide binding	IEA	molecular function
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0071723	lipopeptide binding	ISS	molecular function
GO:0007250	activation of NF-kappaB-inducing kinase activity	NAS	biological process
GO:0045410	positive regulation of interleukin-6 biosynthetic process	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa04620	Toll-like receptor signaling pathway
hsa05142	Chagas disease

Diseases

Associated diseases	References
Asthma	PMID:15266299
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq