• Gene id: 10331

Gene Summary

• Gene Symbol: B3GNT3   Gene   UCSC   Ensembl
• Aliases: B3GAL-T8, B3GN-T3, B3GNT-3, HP10328, TMEM3, beta3Gn-T3
• Gene name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3
• Alternate names: N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3, UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8, UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8, beta-1,3-GalTase 8, beta-1,3-Gn-T3, beta-1,3-N-acetylglucosaminyltr,
• Gene location: 19p13.11 (17794827: 17813575)     Exons: 4     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and
• OMIM: 605893

Protein Summary

• Protein general information: Q9Y2A9  
  • Name: N acetyllactosaminide beta 1,3 N acetylglucosaminyltransferase 3 (EC 2.4.1.149) (Beta 1,3 galactosyl O glycosyl glycoprotein beta 1,3 N acetylglucosaminyltransferase) (EC 2.4.1.146) (Beta 1,3 galactosyltransferase 8) (Beta 1,3 GalTase 8) (Beta3Gal T8) (Be
  • Length: 372  
  • Mass: 42534
  • Tissue specificity: Expressed in colon, jejunum, stomach, esophagus, placenta and trachea. {ECO
• Sequence:

  MKYLRHRRPNATLILAIGAFTLLLFSLLVSPPTCKVQEQPPAIPEALAWPTPPTRPAPAPCHANTSMVTHPDFAT
  QPQHVQNFLLYRHCRHFPLLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTA
  SNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQ
  DHDPGRHLFVGQLIQNVGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSRFTAAALRRAAHVLDIFPIDDVFL
  GMCLELEGLKPASHSGIRTSGVRAPSQRLSSFDPCFYRDLLLVHRFLPYEMLLMWDALNQPNLTCGNQTQIY

• Structural information:
  • Interpro: IPR002659  
  • STRING: ENSP00000321874
• Other Databases: GeneCards:  B3GNT3  Malacards:  B3GNT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030311	poly-N-acetyllactosamine biosynthetic process	IBA	biological process
GO:0008375	acetylglucosaminyltransferase activity	IBA	molecular function
GO:0006486	protein glycosylation	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0016758	transferase activity, transferring hexosyl groups	IBA	molecular function
GO:0008532	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity	IBA	molecular function
GO:0008376	acetylgalactosaminyltransferase activity	IBA	molecular function
GO:0006493	protein O-linked glycosylation	IBA	biological process
GO:0030311	poly-N-acetyllactosamine biosynthetic process	IDA	biological process
GO:0008532	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity	IDA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0047223	beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0008532	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0008457	beta-galactosyl-N-acetylglucosaminylgalactosylglucosyl-ceramide beta-1,3-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0016266	O-glycan processing	TAS	biological process
GO:0018146	keratan sulfate biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00601	Glycosphingolipid biosynthesis - lacto and neolacto series

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881