• Gene id: 10330

Gene Summary

• Gene Symbol: CNPY2   Gene   UCSC   Ensembl
• Aliases: HP10390, MSAP, TMEM4, ZSIG9
• Gene name: canopy FGF signaling regulator 2
• Alternate names: protein canopy homolog 2, MIR-interacting saposin-like protein, putative secreted protein Zsig9, transmembrane protein 4,
• Gene location: 12q13.3 (56316347: 56309843)     Exons: 6     NC_000012.12
• OMIM: 605861

Protein Summary

• Protein general information: Q9Y2B0  
  • Name: Protein canopy homolog 2 (MIR interacting saposin like protein) (Putative secreted protein Zsig9) (Transmembrane protein 4)
  • Length: 182  
  • Mass: 20652
  • Tissue specificity: Expressed in different tissues. Highest levels are detected in adult placenta, liver and pancreas. {ECO
• Sequence:

  MKGWGWLALLLGALLGTAWARRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVPYARSE
  AHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRIDSDISGTLKFACESIVEEYEDELIE
  FFSREADNVKDKLCSKRTDLCDHALHISHDEL

• Structural information:
  • Protein Domains: (24..17-)
    (/note="Saposin-B-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00415"-)
  • Interpro: IPR042415  IPR021852  IPR008139  
  • Prosite: PS00014 PS50015
  • DIP: 50705
  • STRING: ENSP00000273308
• Other Databases: GeneCards:  CNPY2  Malacards:  CNPY2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010988	regulation of low-density lipoprotein particle clearance	ISS	biological process
GO:0045716	positive regulation of low-density lipoprotein particle receptor biosynthetic process	ISS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881