• Gene id: 1033

Gene Summary

• Gene Symbol: CDKN3   Gene   UCSC   Ensembl
• Aliases: CDI1, CIP2, KAP, KAP1
• Gene name: cyclin dependent kinase inhibitor 3
• Alternate names: cyclin-dependent kinase inhibitor 3, CDK2-associated dual specificity phosphatase, Cdk-associated protein phosphatase, cyclin-dependent kinase inhibitor, cyclin-dependent kinase interacting protein 2, cyclin-dependent kinase interactor 1, kinase-associated phos,
• Gene location: 14q22.2 (54396867: 54420217)     Exons: 9     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK
• OMIM: 123832

Protein Summary

• Protein general information: Q16667  
  • Name: Cyclin dependent kinase inhibitor 3 (EC 3.1.3.16) (EC 3.1.3.48) (CDK2 associated dual specificity phosphatase) (Cyclin dependent kinase interactor 1) (Cyclin dependent kinase interacting protein 2) (Kinase associated phosphatase)
  • Length: 212  
  • Mass: 23805
• Sequence:

  MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDI
  FVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLV
  AACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR

• Structural information:
  • Interpro: IPR008425  IPR022778  IPR029021  IPR003595  IPR000387  
  • Prosite: PS50056
  • PDB: 1FPZ 1FQ1
  • PDBsum: 1FPZ 1FQ1
  • DIP: 245
  • STRING: ENSP00000335357
• Other Databases: GeneCards:  CDKN3  Malacards:  CDKN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060271	cilium assembly	IBA	biological process
GO:0007050	cell cycle arrest	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	TAS	molecular function
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0007050	cell cycle arrest	IDA	biological process
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
hepatocellular carcinoma	PMID:22390936
hepatocellular carcinoma	PMID:23292002
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray