• Gene id: 10327

Gene Summary

• Gene Symbol: AKR1A1   Gene   UCSC   Ensembl
• Aliases: ALDR1, ALR, ARM, DD3, HEL-S-6
• Gene name: aldo-keto reductase family 1 member A1
• Alternate names: aldo-keto reductase family 1 member A1, HEL-S-165mP, alcohol dehydrogenase, aldehyde reductase, dihydrodiol dehydrogenase 3, epididymis secretory protein Li 6, epididymis secretory sperm binding protein Li 165mP, glucuronate reductase, glucuronolactone reductase,
• Gene location: 1p34.1 (82716705: 82728016)     Exons: 8     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present i
• OMIM: 103830

Protein Summary

• Protein general information: P14550  
  • Name: Aldo keto reductase family 1 member A1 (EC 1.1.1.2) (EC 1.1.1.372) (EC 1.1.1.54) (Alcohol dehydrogenase [NADP(+)]) (Aldehyde reductase) (Glucuronate reductase) (EC 1.1.1.19) (Glucuronolactone reductase) (EC 1.1.1.20)
  • Length: 325  
  • Mass: 36573
  • Tissue specificity: Widely expressed. Highly expressed in kidney, salivary gland and liver. Detected in trachea, stomach, brain, lung, prostate, placenta, mammary gland, small intestine and lung. {ECO
• Sequence:

  MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREEL
  FVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHYKETWKALEAL
  VAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDE
  PVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIV
  PMLTVDGKRVPRDAGHPLYPFNDPY

• Structural information:
  • Interpro: IPR018170  IPR020471  IPR023210  IPR036812  
  • Prosite: PS00798 PS00062 PS00063
  • CDD: cd06660
  • PDB: 2ALR
  • PDBsum: 2ALR
  • STRING: ENSP00000361140
• Other Databases: GeneCards:  AKR1A1  Malacards:  AKR1A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0008106	alcohol dehydrogenase (NADP+) activity	IBA	molecular function
GO:0019853	L-ascorbic acid biosynthetic process	IBA	biological process
GO:0042840	D-glucuronate catabolic process	IBA	biological process
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	IBA	molecular function
GO:0016491	oxidoreductase activity	IBA	molecular function
GO:0046185	aldehyde catabolic process	IBA	biological process
GO:0047941	glucuronolactone reductase activity	IDA	molecular function
GO:0047939	L-glucuronate reductase activity	IDA	molecular function
GO:0044598	doxorubicin metabolic process	IDA	biological process
GO:0044597	daunorubicin metabolic process	IDA	biological process
GO:0110095	cellular detoxification of aldehyde	ISS	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0004745	retinol dehydrogenase activity	ISS	NOT|molecular function
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	TAS	molecular function
GO:0006081	cellular aldehyde metabolic process	TAS	biological process
GO:0006006	glucose metabolic process	TAS	biological process
GO:0047941	glucuronolactone reductase activity	IEA	molecular function
GO:0047655	allyl-alcohol dehydrogenase activity	IEA	molecular function
GO:0047939	L-glucuronate reductase activity	IEA	molecular function
GO:0008106	alcohol dehydrogenase (NADP+) activity	IEA	molecular function
GO:0047939	L-glucuronate reductase activity	EXP	molecular function
GO:0004033	aldo-keto reductase (NADP) activity	TAS	molecular function
GO:0019640	glucuronate catabolic process to xylulose 5-phosphate	TAS	biological process
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0110095	cellular detoxification of aldehyde	IEA	biological process
GO:0047941	glucuronolactone reductase activity	IEA	molecular function
GO:0047939	L-glucuronate reductase activity	IEA	molecular function
GO:0042840	D-glucuronate catabolic process	IEA	biological process
GO:0019853	L-ascorbic acid biosynthetic process	IEA	biological process
GO:0110095	cellular detoxification of aldehyde	IEA	biological process
GO:0047941	glucuronolactone reductase activity	IEA	molecular function
GO:0047939	L-glucuronate reductase activity	IEA	molecular function
GO:0042840	D-glucuronate catabolic process	IEA	biological process
GO:0019853	L-ascorbic acid biosynthetic process	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0046185	aldehyde catabolic process	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0022900	electron transport chain	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0009055	electron transfer activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00561	Glycerolipid metabolism
hsa00010	Glycolysis / Gluconeogenesis
hsa00040	Pentose and glucuronate interconversions

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881