• Gene id: 10325

Gene Summary

• Gene Symbol: RRAGB   Gene   UCSC   Ensembl
• Aliases: RAGB, bA465E19.1
• Gene name: Ras related GTP binding B
• Alternate names: ras-related GTP-binding protein B, GTP-binding protein ragB, rag B,
• Gene location: Xp11.21 (51875600: 51873720)     Exons: 2     NC_000003.12
• Gene summary(Entrez): Ras-homologous GTPases constitute a large family of signal transducers that alternate between an activated, GTP-binding state and an inactivated, GDP-binding state. These proteins represent cellular switches that are operated by GTP-exchange factors and f
• OMIM: 300725

Protein Summary

• Protein general information: Q5VZM2  
  • Name: Ras related GTP binding protein B (Rag B) (RagB) (EC 3.6.5. )
  • Length: 374  
  • Mass: 43250
• Sequence:

  MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGAT
  ILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLI
  YVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSI
  WDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFK
  LSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLMR

• Structural information:
  • Interpro: IPR006762  IPR027417  IPR039397  
  • CDD: cd11384
  • DIP: 37518
  • STRING: ENSP00000262850
• Other Databases: GeneCards:  RRAGB  Malacards:  RRAGB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005525	GTP binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0009267	cellular response to starvation	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0005764	lysosome	IBA	cellular component
GO:0010506	regulation of autophagy	IBA	biological process
GO:0032008	positive regulation of TOR signaling	IBA	biological process
GO:0034448	EGO complex	IBA	cellular component
GO:0071230	cellular response to amino acid stimulus	IBA	biological process
GO:1990131	Gtr1-Gtr2 GTPase complex	IBA	cellular component
GO:0032561	guanyl ribonucleotide binding	IDA	molecular function
GO:0005764	lysosome	IDA	cellular component
GO:0071230	cellular response to amino acid stimulus	IMP	biological process
GO:0032008	positive regulation of TOR signaling	IMP	biological process
GO:0034613	cellular protein localization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1904263	positive regulation of TORC1 signaling	IMP	biological process
GO:1990253	cellular response to leucine starvation	IMP	biological process
GO:0005525	GTP binding	IMP	molecular function
GO:0051020	GTPase binding	IPI	molecular function
GO:0051020	GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032006	regulation of TOR signaling	IGI	biological process
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0005525	GTP binding	IMP	molecular function
GO:0034198	cellular response to amino acid starvation	IGI	biological process

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04150	mTOR signaling pathway
hsa04140	Autophagy - animal

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)