About Us

Search Result


Gene id 10320
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol IKZF1   Gene   UCSC   Ensembl
Aliases CVID13, Hs.54452, IK1, IKAROS, LYF1, LyF-1, PPP1R92, PRO0758, ZNFN1A1
Gene name IKAROS family zinc finger 1
Alternate names DNA-binding protein Ikaros, CLL-associated antigen KW-6, ikaros family zinc finger protein 1, lymphoid transcription factor LyF-1, protein phosphatase 1, regulatory subunit 92, zinc finger protein, subfamily 1A, 1 (Ikaros),
Gene location 7p12.2 (50303452: 50405100)     Exons: 15     NC_000007.14
Gene summary(Entrez) This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions a
OMIM 603023

Protein Summary

Protein general information Q13422  

Name: DNA binding protein Ikaros (Ikaros family zinc finger protein 1) (Lymphoid transcription factor LyF 1)

Length: 519  Mass: 57528

Tissue specificity: Abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. Lower expression in bone marrow and small intestine. {ECO

Sequence MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNG
EECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQC
GASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHN
YLESMGLPGTLYPVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYE
KENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQLHKPLAEGTPRSNHSAQDSAVENLLL
LSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALR
VVSTSGEQMKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS
Structural information
Interpro:  IPR036236  IPR013087  
Prosite:   PS00028 PS50157

PDB:  
6H0F
PDBsum:   6H0F

DIP:  

41110

MINT:  
STRING:   ENSP00000331614
Other Databases GeneCards:  IKZF1  Malacards:  IKZF1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005654 nucleoplasm
IBA cellular component
GO:0003700 DNA-binding transcription
factor activity
IBA molecular function
GO:0000978 RNA polymerase II cis-reg
ulatory region sequence-s
pecific DNA binding
IBA molecular function
GO:0000976 transcription regulatory
region sequence-specific
DNA binding
IBA molecular function
GO:0045944 positive regulation of tr
anscription by RNA polyme
rase II
IBA biological process
GO:0000977 RNA polymerase II transcr
iption regulatory region
sequence-specific DNA bin
ding
IBA molecular function
GO:0003677 DNA binding
IDA molecular function
GO:0005634 nucleus
IDA cellular component
GO:0003677 DNA binding
IDA molecular function
GO:0031618 nuclear pericentric heter
ochromatin
IDA cellular component
GO:0005634 nucleus
IDA cellular component
GO:0045892 negative regulation of tr
anscription, DNA-template
d
ISS biological process
GO:0030098 lymphocyte differentiatio
n
IMP biological process
GO:0030218 erythrocyte differentiati
on
IMP biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0006325 chromatin organization
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0007049 cell cycle
IEA biological process
GO:0007275 multicellular organism de
velopment
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0003677 DNA binding
TAS molecular function
GO:0007498 mesoderm development
TAS biological process
GO:0032991 protein-containing comple
x
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0032991 protein-containing comple
x
IMP cellular component
GO:0005515 protein binding
IPI molecular function
GO:0019904 protein domain specific b
inding
IPI molecular function
Associated diseases References
Common variable immunodeficiency KEGG:H00088
Common variable immunodeficiency KEGG:H00088
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract