Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 1032
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol CDKN2D   Gene   UCSC   Ensembl
Aliases INK4D, p19, p19-INK4D
Gene name cyclin dependent kinase inhibitor 2D
Alternate names cyclin-dependent kinase 4 inhibitor D, CDK inhibitor p19INK4d, cell cycle inhibitor, Nur77 associating protein, cyclin-dependent kinase 4 inhibitor D p19, cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4), inhibitor of cyclin-dependent kinase 4d,
Gene location 19p13.2 (10568978: 10566459)     Exons: 2     NC_000019.10
Gene summary(Entrez) The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth re
OMIM 600927

Protein Summary
Protein general information P55273  

Name: Cyclin dependent kinase 4 inhibitor D (p19 INK4d)

Length: 166  Mass: 17700

Sequence MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGT
SPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRG
AQDLVDILQGHMVAPL
Structural information
Interpro:  IPR002110  IPR020683  IPR036770  
Prosite:   PS50297 PS50088

PDB:  		 1BD8 1BI8
PDBsum:   1BD8 1BI8

DIP:  
6109
MINT:  
STRING:   ENSP00000377224
Other Databases GeneCards:  CDKN2D  Malacards:  CDKN2D

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0007049 cell cycle
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005829 cytosol
 TAS cellular component
GO:2000134 negative regulation of G1
/S transition of mitotic
cell cycle
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:1902807 negative regulation of ce
ll cycle G1/S phase trans
ition
 IEA biological process
GO:0007605 sensory perception of sou
nd
 IEA biological process
GO:0019901 protein kinase binding
 IEA molecular function
GO:0097129 cyclin D2-CDK4 complex
 IEA cellular component
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
 IDA molecular function
GO:0019901 protein kinase binding
 IPI molecular function
GO:0019901 protein kinase binding
 IPI molecular function
GO:0000082 G1/S transition of mitoti
c cell cycle
 IDA biological process
GO:0007050 cell cycle arrest
 IDA biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IDA biological process
GO:0030308 negative regulation of ce
ll growth
 IDA biological process
GO:0042326 negative regulation of ph
osphorylation
 IDA biological process
GO:0000731 DNA synthesis involved in
DNA repair
 IMP biological process
GO:0048102 autophagic cell death
 IMP biological process
GO:0000079 regulation of cyclin-depe
ndent protein serine/thre
onine kinase activity
 IDA biological process
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0009411 response to UV
 IMP biological process
GO:0032526 response to retinoic acid
 IMP biological process
GO:0033280 response to vitamin D
 IMP biological process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
 IMP biological process
GO:1902230 negative regulation of in
trinsic apoptotic signali
ng pathway in response to
DNA damage
 IMP biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0045736 negative regulation of cy
clin-dependent protein se
rine/threonine kinase act
ivity
 IEA biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04110Cell cycle
hsa04068FoxO signaling pathway

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
31037746 Spermatoge
nic defect
s
28 men with az
oospermia
 Male infertility Microarray
 Show abstract