• Gene id: 10316

Gene Summary

• Gene Symbol: NMUR1   Gene   UCSC   Ensembl
• Aliases: (FM-3), FM-3, FM3, GPC-R, GPR66, NMU1R
• Gene name: neuromedin U receptor 1
• Alternate names: neuromedin-U receptor 1, G-protein coupled receptor 66, G-protein coupled receptor FM-3, NMU-R1,
• Gene location: 2q37.1 (231530455: 231519902)     Exons: 5     NC_000002.12
• OMIM: 611922

Protein Summary

• Protein general information: Q9HB89  
  • Name: Neuromedin U receptor 1 (NMU R1) (G protein coupled receptor 66) (G protein coupled receptor FM 3)
  • Length: 426  
  • Mass: 47351
  • Tissue specificity: Expressed in greatest abundance in peripheral organs, particularly in elements of the gastrointestinal and urogenital systems with highest levels in testes. In central nervous system structures express levels are much lower than those
• Sequence:

  MTPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMPICATYLLIFVVGA
  VGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLLVLLVGLPLELYEMWHNYPFLLGVGGCYFRTLLFEMVCLASVL
  NVTALSVERYVAVVHPLQARSMVTRAHVRRVLGAVWGLAMLCSLPNTSLHGIRQLHVPCRGPVPDSAVCMLVRPR
  ALYNMVVQTTALLFFCLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLF
  VLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSAANPVLYSLMSSRFRETFQEALCLGA
  CCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR005390  IPR005391  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000305877
• Other Databases: GeneCards:  NMUR1  Malacards:  NMUR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001607	neuromedin U receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0008188	neuropeptide receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0097731	9+0 non-motile cilium	IEA	cellular component
GO:0008188	neuropeptide receptor activity	IEA	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007202	activation of phospholipase C activity	IDA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0048016	inositol phosphate-mediated signaling	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0042924	neuromedin U binding	IDA	molecular function
GO:0042924	neuromedin U binding	IDA	molecular function
GO:0006821	chloride transport	IDA	biological process
GO:0006816	calcium ion transport	IDA	biological process
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0001607	neuromedin U receptor activity	IDA	molecular function
GO:0001607	neuromedin U receptor activity	IDA	molecular function
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0001607	neuromedin U receptor activity	IDA	molecular function
GO:0007218	neuropeptide signaling pathway	TAS	biological process
GO:0006939	smooth muscle contraction	IEP	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0001607	neuromedin U receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0008188	neuropeptide receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0097731	9+0 non-motile cilium	IEA	cellular component
GO:0008188	neuropeptide receptor activity	IEA	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007202	activation of phospholipase C activity	IDA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0048016	inositol phosphate-mediated signaling	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0042924	neuromedin U binding	IDA	molecular function
GO:0042924	neuromedin U binding	IDA	molecular function
GO:0006821	chloride transport	IDA	biological process
GO:0006816	calcium ion transport	IDA	biological process
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0001607	neuromedin U receptor activity	IDA	molecular function
GO:0001607	neuromedin U receptor activity	IDA	molecular function
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0001607	neuromedin U receptor activity	IDA	molecular function
GO:0007218	neuropeptide signaling pathway	TAS	biological process
GO:0006939	smooth muscle contraction	IEP	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq