• Gene id: 10314

Gene Summary

• Gene Symbol: LANCL1   Gene   UCSC   Ensembl
• Aliases: GPR69A, p40
• Gene name: LanC like 1
• Alternate names: glutathione S-transferase LANCL1, 40 kDa erythrocyte membrane protein, G protein-coupled receptor 69A, LanC (bacterial lantibiotic synthetase component C)-like 1, LanC (bacterial lantibiotic synthetase component), LanC lantibiotic synthetase component C-like 1,
• Gene location: 2q34 (210477617: 210431248)     Exons: 12     NC_000002.12
• Gene summary(Entrez): This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme comp
• OMIM: 604155

Protein Summary

• Protein general information: O43813  
  • Name: Glutathione S transferase LANCL1 (EC 2.5.1.18) (40 kDa erythrocyte membrane protein) (p40) (LanC like protein 1)
  • Length: 399  
  • Mass: 45283
  • Tissue specificity: Detected in erythrocytes, brain, kidney, testis, ovary, heart, lung, placenta and spleen (at protein level). Ubiquitous. Strongly expressed in brain, spinal cord, pituitary gland, kidney, heart, skeletal muscle, pancreas, ovary and tes
• Sequence:

  MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHL
  YDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNE
  MLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIY
  YYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLC
  DAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEG
  MAGTIYFLADLLVPTKARFPAFEL

• Structural information:
  • Interpro: IPR012341  IPR007822  IPR020464  
  • CDD: cd04794
  • PDB: 3E6U 3E73
  • PDBsum: 3E6U 3E73
  • STRING: ENSP00000388713
• Other Databases: GeneCards:  LANCL1  Malacards:  LANCL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0043295	glutathione binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IDA	NOT|biological process
GO:0005887	integral component of plasma membrane	IDA	NOT|cellular component
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0043523	regulation of neuron apoptotic process	ISS	biological process
GO:0004364	glutathione transferase activity	ISS	molecular function
GO:1903203	regulation of oxidative stress-induced neuron death	ISS	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043523	regulation of neuron apoptotic process	IEA	biological process
GO:1903203	regulation of oxidative stress-induced neuron death	IEA	biological process
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)