• Gene id: 1031

Gene Summary

• Gene Symbol: CDKN2C   Gene   UCSC   Ensembl
• Aliases: INK4C, p18, p18-INK4C
• Gene name: cyclin dependent kinase inhibitor 2C
• Alternate names: cyclin-dependent kinase 4 inhibitor C, CDK6 inhibitor p18, cyclin-dependent inhibitor, cyclin-dependent kinase 6 inhibitor p18, cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4), p18-INK6,
• Gene location: 1p32.3 (50968694: 50974633)     Exons: 3     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that
• OMIM: 612464

Protein Summary

• Protein general information: P42773  
  • Name: Cyclin dependent kinase 4 inhibitor C (Cyclin dependent kinase 6 inhibitor) (p18 INK4c) (p18 INK6)
  • Length: 168  
  • Mass: 18127
  • Tissue specificity: Highest levels found in skeletal muscle. Also found in pancreas and heart.
• Sequence:

  MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIH
  DAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRN
  EVVSLMQANGAGGATNLQ

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  
  • Prosite: PS50297 PS50088
  • PDB: 1BU9 1G3N 1IHB 1MX2 1MX4 1MX6
  • PDBsum: 1BU9 1G3N 1IHB 1MX2 1MX4 1MX6
  • STRING: ENSP00000262662
• Other Databases: GeneCards:  CDKN2C  Malacards:  CDKN2C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007049	cell cycle	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0048709	oligodendrocyte differentiation	IEA	biological process
GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity	IDA	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0000082	G1/S transition of mitotic cell cycle	IDA	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0042326	negative regulation of phosphorylation	IDA	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa05202	Transcriptional misregulation in cancer
hsa04934	Cushing syndrome
hsa04110	Cell cycle
hsa01522	Endocrine resistance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881