• Gene id: 10309

Gene Summary

• Gene Symbol: CCNO   Gene   UCSC   Ensembl
• Aliases: CCNU, CILD29, UDG2
• Gene name: cyclin O
• Alternate names: cyclin-O, cyclin U, cyclin domain containing,
• Gene location: 5q11.2 (55233716: 55231151)     Exons: 3     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the cyclin protein family, and the encoded protein is involved in regulation of the cell cycle. Disruption of this gene is associated with primary ciliary dyskinesia-19. Alternative splicing results in multiple transcript var
• OMIM: 607129

Protein Summary

• Protein general information: P22674  
  • Name: Cyclin O
  • Length: 350  
  • Mass: 38096
  • Tissue specificity: Present in respiratory cells (at protein level). {ECO
• Sequence:

  MVTPCPTSPSSPAARAGRRDNDQNLRAPVKKSRRPRLRRKQPLHPLNPCPLPGDSGICDLFESPSSGSDGAESPS
  AARGGSPLPGPAQPVAQLDLQTFRDYGQSCYAFRKAQESHFHPREALARQPQVTAESRCKLLSWLIPVHRQFGLS
  FESLCLTVNTLDRFLTTTPVAADCFQLLGVTSLLIACKQVEVHPPRVKQLLALCCGAFSRQQLCNLECIVLHKLH
  FTLGAPTISFFLEHFTHARVEAGQAEASEALEAQALARGVAELSLADYAFTSYSPSLLAICCLALADRMLRVSRP
  VDLRLGDHPEAALEDCMGKLQLLVAINSTSLTHMLPVQICEKCSLPPSSK

• Structural information:
  • Interpro: IPR028864  IPR039361  IPR013763  IPR036915  IPR004367   IPR006671  
  • CDD: cd00043
  • DIP: 24234
  • STRING: ENSP00000282572
• Other Databases: GeneCards:  CCNO  Malacards:  CCNO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0044772	mitotic cell cycle phase transition	IBA	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IBA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:1903251	multi-ciliated epithelial cell differentiation	IMP	biological process
GO:0060271	cilium assembly	IMP	biological process
GO:0042025	host cell nucleus	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000278	mitotic cell cycle	IDA	biological process

Diseases

Associated diseases	References
Primary ciliary dyskinesia	KEGG:H00564
Primary ciliary dyskinesia	KEGG:H00564
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray