• Gene id: 10302

Gene Summary

• Gene Symbol: SNAPC5   Gene   UCSC   Ensembl
• Aliases: SNAP19
• Gene name: small nuclear RNA activating complex polypeptide 5
• Alternate names: snRNA-activating protein complex subunit 5, SNAPc 19 kDa subunit, SNAPc subunit 5, snRNA-activating protein complex 19 kDa subunit,
• Gene location: 15q22.31 (66497814: 66489747)     Exons: 4     NC_000015.10
• Gene summary(Entrez): This gene encodes a subunit of the small nuclear RNA (snRNA)-activating protein complex that plays a role in the transcription of snRNA genes. This complex binds to the promoters of snRNA genes transcribed by either RNA polymerase II or III and recruits o
• OMIM: 605979

Protein Summary

• Protein general information: O75971  
  • Name: snRNA activating protein complex subunit 5 (SNAPc subunit 5) (Small nuclear RNA activating complex polypeptide 5) (snRNA activating protein complex 19 kDa subunit) (SNAPc 19 kDa subunit)
  • Length: 98  
  • Mass: 11328
• Sequence:

  MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSHDMLVHVDNEASINQTT
  LELSTKSHVTEEEEEEEEEESDS

• Structural information:
  • Interpro: IPR029138  
  • STRING: ENSP00000319597
• Other Databases: GeneCards:  SNAPC5  Malacards:  SNAPC5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006366	transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006384	transcription initiation from RNA polymerase III promoter	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0000995	RNA polymerase III general transcription initiation factor activity	IDA	molecular function
GO:0042795	snRNA transcription by RNA polymerase II	IDA	biological process
GO:0042796	snRNA transcription by RNA polymerase III	IDA	biological process
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881