• Gene id: 10300

Gene Summary

• Gene Symbol: KATNB1   Gene   UCSC   Ensembl
• Aliases: KAT, LIS6
• Gene name: katanin regulatory subunit B1
• Alternate names: katanin p80 WD40 repeat-containing subunit B1, katanin (80 kDa), katanin p80 (WD repeat containing) subunit B 1, katanin p80 (WD40-containing) subunit B 1, katanin p80 WD40-containing subunit B1, katanin p80 subunit B1, p80 katanin,
• Gene location: 16q21 (57735601: 57757249)     Exons: 21     NC_000016.10
• Gene summary(Entrez): Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa
• OMIM: 602703

Protein Summary

• Protein general information: Q9BVA0  
  • Name: Katanin p80 WD40 repeat containing subunit B1 (Katanin p80 subunit B1) (p80 katanin)
  • Length: 655  
  • Mass: 72,334
• Sequence:

  MATPVVTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSPVESVRLNTPE
  ELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAV
  RCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWDLEKFQVVS
  CIEGEPGPVRSVLFNPDGCCLYSGCQDSLRVYGWEPERCFDVVLVNWGKVADLAICNDQLIGVAFSQSNVSSYVV
  DLTRVTRTGTVARDPVQDHRPLAQPLPNPSAPLRRIYERPSTTCSKPQRVKQNSESERRSPSSEDDRDERESRAE
  IQNAEDYNEIFQPKNSISRTPPRRSEPFPAPPEDDAATAKEAAKPSPAMDVQFPVPNLEVLPRPPVVASTPAPKA
  EPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCVVLTSRHKNLDTVRAVWTMGDIKTSV
  DSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDMLAAP
  PSVGVDISREERLHKCRLCYKQLKSISGLVKSKSGLSGRHGSTFRELHLLMASLD

• Structural information:
  • Interpro: IPR020472  IPR026962  IPR028021  IPR015943  IPR001680   IPR019775  IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000368982
• Other Databases: GeneCards:  KATNB1  Malacards:  KATNB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005813	centrosome	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006605	protein targeting	NAS	biological process
GO:0007026	negative regulation of microtubule depolymerization	IMP	biological process
GO:0007079	mitotic chromosome movement towards spindle pole	IEA	biological process
GO:0008017	microtubule binding	NAS	molecular function
GO:0008352	katanin complex	TAS	cellular component
GO:0008352	katanin complex	IDA	cellular component
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0031117	positive regulation of microtubule depolymerization	IMP	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0045502	dynein binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0051013	microtubule severing	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0000922	spindle pole	IDA	cellular component
GO:0008568	microtubule-severing ATPase activity	IDA	molecular function
GO:0000922	spindle pole	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005813	centrosome	IEA	cellular component
GO:0005813	centrosome	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006605	protein targeting	NAS	biological process
GO:0007026	negative regulation of microtubule depolymerization	IMP	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007079	mitotic chromosome movement towards spindle pole	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0008017	microtubule binding	NAS	molecular function
GO:0008352	katanin complex	IEA	cellular component
GO:0008352	katanin complex	TAS	cellular component
GO:0008352	katanin complex	IDA	cellular component
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0031117	positive regulation of microtubule depolymerization	IEA	biological process
GO:0031117	positive regulation of microtubule depolymerization	IMP	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0045502	dynein binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0051013	microtubule severing	IEA	biological process
GO:0051013	microtubule severing	IEA	biological process
GO:0051013	microtubule severing	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0000922	spindle pole	IDA	cellular component
GO:0008568	microtubule-severing ATPase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006605	protein targeting	NAS	biological process
GO:0007026	negative regulation of microtubule depolymerization	IMP	biological process
GO:0008017	microtubule binding	NAS	molecular function
GO:0008352	katanin complex	TAS	cellular component
GO:0008352	katanin complex	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0031117	positive regulation of microtubule depolymerization	IMP	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0000922	spindle pole	IDA	cellular component
GO:0008568	microtubule-severing ATPase activity	IDA	molecular function

Diseases

Associated diseases	References
Cancer (breast)	GAD: 20508983
Lissencephaly	OMIM: 602703
Oligoasthenoteratozoospermia	MIK: 25280067
Male factor infertility	MIK: 25280067
Cryptorchidism	MIK: 28606200
Oligoasthenoteratozoospermia (OAT)	MIK: 25280067
Role in flagella formation in sperm	MIK: 27717557
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25280067	Oligoasthenoteratozoospermia (OAT)		Austral ian	200 (100 Oligoasthenoteratozoospermia (OAT) infertile, 100 proven fertile men)	Male infertility
27717557	Role in flagella formation in sperm, Male infertility			80 (43 showing normal spermatogenesis, 9 with maturation arrest at level of spermatocytes, 8 with maturation arrest at level of spermatogonia, and 20 with a Sertoli cell only syndrome)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray