• Gene id: 1030

Gene Summary

• Gene Symbol: CDKN2B   Gene   UCSC   Ensembl
• Aliases: CDK4I, INK4B, MTS2, P15, TP15, p15INK4b
• Gene name: cyclin dependent kinase inhibitor 2B
• Alternate names: cyclin-dependent kinase 4 inhibitor B, CDK inhibitory protein, CDK4B inhibitor, MTS-2, cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4), cyclin-dependent kinases 4 and 6 binding protein, multiple tumor suppressor 2, p14-INK4b, p14_CDK inhibitor, p14_INK4B,
• Gene location: 9p21.3 (22009312: 22002902)     Exons: 2     NC_000009.12
• Gene summary(Entrez): This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the ac
• OMIM: 600431

Protein Summary

• Protein general information: P42772  
  • Name: Cyclin dependent kinase 4 inhibitor B (Multiple tumor suppressor 2) (MTS 2) (p14 INK4b) (p15 INK4b) (p15INK4B)
  • Length: 138  
  • Mass: 14722
  • Tissue specificity: Isoform 2 is expressed in normal (keratinocytes, fibroblasts) and tumor cell lines. {ECO
• Sequence:

  MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCA
  DPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD

• Structural information:
  • Interpro: IPR020683  IPR036770  
  • Prosite: PS50297
  • STRING: ENSP00000276925
• Other Databases: GeneCards:  CDKN2B  Malacards:  CDKN2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0090398	cellular senescence	IMP	biological process
GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity	IDA	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0042326	negative regulation of phosphorylation	IDA	biological process
GO:0000086	G2/M transition of mitotic cell cycle	IMP	biological process
GO:0007050	cell cycle arrest	IMP	biological process
GO:0007093	mitotic cell cycle checkpoint	IMP	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0031668	cellular response to extracellular stimulus	IMP	biological process
GO:0050680	negative regulation of epithelial cell proliferation	IMP	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0031670	cellular response to nutrient	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0030219	megakaryocyte differentiation	IEP	biological process
GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05166	Human T-cell leukemia virus 1 infection
hsa05203	Viral carcinogenesis
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04218	Cellular senescence
hsa04110	Cell cycle
hsa04068	FoxO signaling pathway
hsa04350	TGF-beta signaling pathway
hsa05222	Small cell lung cancer

Diseases

Associated diseases	References
Type 2 diabetes mellitus	KEGG:H00409
Meningioma	KEGG:H01556
Malignant pleural mesothelioma	KEGG:H00015
Osteosarcoma	KEGG:H00036
Type 2 diabetes mellitus	KEGG:H00409
Meningioma	KEGG:H01556
Malignant pleural mesothelioma	KEGG:H00015
Mycosis fungoides	KEGG:H01463
Osteosarcoma	KEGG:H00036
Myelodysplastic syndrome	PMID:17611569
Cutaneous T cell lymphoma	PMID:20118908
Acute promyelocytic leukemia	PMID:12750706
chronic myelomonocytic leukemia	PMID:12750705
Prostate cancer	PMID:16799475
open-angle glaucoma	PMID:22840486
urinary bladder cancer	PMID:15590562
urinary bladder cancer	PMID:16624482
Squamous cell carcinoma	PMID:18564286
Transitional cell carcinoma	PMID:11720438
Transitional cell carcinoma	PMID:11720438
Granulosa cell tumor	PMID:12203782
Esophagus squamous cell carcinoma	PMID:23361049
lung non-small cell carcinoma	PMID:11445839
cervix uteri carcinoma in situ	PMID:17632454
acute myeloid leukemia	PMID:9001419
acute myeloid leukemia	PMID:27168825
acute myeloid leukemia	PMID:11064355
acute myeloid leukemia	PMID:25616284
acute myeloid leukemia	PMID:15863205
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881