• Gene id: 10299

Gene Summary

• Gene Symbol: MARCHF6   Gene   UCSC   Ensembl
• Aliases: DOA10, FAME3, MARCH-VI, MARCH6, RNF176, TEB4
• Gene name: membrane associated ring-CH-type finger 6
• Alternate names: E3 ubiquitin-protein ligase MARCHF6, E3 ubiquitin-protein ligase MARCH6, RING finger protein 176, RING-type E3 ubiquitin transferase MARCH6, RING-type E3 ubiquitin transferase MARCHF6, doa10 homolog, membrane associated ring finger 6, membrane-associated RING fi,
• Gene location: 5p15.2 (10353692: 10440387)     Exons: 31     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of a family of membrane-associated E3 ubiquitin ligases containing RING-CH-type zinc finger motifs. Ubiquitination of type II deiodinase by the encoded protein is an important regulatory step in thyroid hormone signalling. Alter

Protein Summary

• Protein general information: O60337  
  • Name: E3 ubiquitin protein ligase MARCHF6 (EC 2.3.2.27) (Doa10 homolog) (Membrane associated RING finger protein 6) (Membrane associated RING CH protein VI) (MARCH VI) (Protein TEB 4) (RING finger protein 176) (RING type E3 ubiquitin transferase MARCHF6)
  • Length: 910  
  • Mass: 102545
  • Tissue specificity: Present in brain (at protein level). {ECO
• Sequence:

  MDTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPI
  QDIFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFTGSVSSLLTLPLDMLSTENLLADCLQGCFVV
  TCTLCAFISLVWLREQIVHGGAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPANPPAENAVVGENPDAQ
  DDQAEEEEEDNEEEDDAGVEDAADANNGAQDDMNWNALEWDRAAEELTWERMLGLDGSLVFLEHVFWVVSLNTLF
  ILVFAFCPYHIGHFSLVGLGFEEHVQASHFEGLITTIVGYILLAITLIICHGLATLVKFHRSRRLLGVCYIVVKV
  SLLVVVEIGVFPLICGWWLDICSLEMFDATLKDRELSFQSAPGTTMFLHWLVGMVYVFYFASFILLLREVLRPGV
  LWFLRNLNDPDFNPVQEMIHLPIYRHLRRFILSVIVFGSIVLLMLWLPIRIIKSVLPNFLPYNVMLYSDAPVSEL
  SLELLLLQVVLPALLEQGHTRQWLKGLVRAWTVTAGYLLDLHSYLLGDQEENENSANQQVNNNQHARNNNAIPVV
  GEGLHAAHQAILQQGGPVGFQPYRRPLNFPLRIFLLIVFMCITLLIASLICLTLPVFAGRWLMSFWTGTAKIHEL
  YTAACGLYVCWLTIRAVTVMVAWMPQGRRVIFQKVKEWSLMIMKTLIVAVLLAGVVPLLLGLLFELVIVAPLRVP
  LDQTPLFYPWQDWALGVLHAKIIAAITLMGPQWWLKTVIEQVYANGIRNIDLHYIVRKLAAPVISVLLLSLCVPY
  VIASGVVPLLGVTAEMQNLVHRRIYPFLLMVVVLMAILSFQVRQFKRLYEHIKNDKYLVGQRLVNYERKSGKQGS
  SPPPPQSSQE

• Structural information:
  • Interpro: IPR011016  IPR013083  
  • Prosite: PS51292
  • DIP: 56134
  • STRING: ENSP00000274140
• Other Databases: GeneCards:  MARCHF6  Malacards:  MARCHF6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000835	ER ubiquitin ligase complex	IC	cellular component
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:1990381	ubiquitin-specific protease binding	IPI	molecular function
GO:0010498	proteasomal protein catabolic process	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0036503	ERAD pathway	TAS	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0031624	ubiquitin conjugating enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:1904380	endoplasmic reticulum mannose trimming	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0044322	endoplasmic reticulum quality control compartment	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IMP	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)