• Gene id: 10297

Gene Summary

• Gene Symbol: APC2   Gene   UCSC   Ensembl
• Aliases: APCL
• Gene name: APC regulator of WNT signaling pathway 2
• Alternate names: adenomatous polyposis coli protein 2, APC2, WNT signaling pathway regulator, adenomatosis polyposis coli 2, adenomatous polyposis coli like,
• Gene location: 19p13.3 (1446267: 1473243)     Exons: 17     NC_000019.10
• Gene summary(Entrez): This gene encodes a strongly conserved protein that has an N-terminal coiled-coil domain followed by an armadillo domain, five 20-amino acid repeats, and two SAMP domains. This protein promotes the assembly of a multiprotein complex that recruits and phos
• OMIM: 610034

Protein Summary

• Protein general information: O95996  
  • Name: Adenomatous polyposis coli protein 2 (Adenomatous polyposis coli protein like) (APC like)
  • Length: 2303  
  • Mass: 243949
  • Tissue specificity: Widely expressed (at protein level). Specifically expressed in the CNS. {ECO
• Sequence:

  MASSVAPYEQLVRQVEALKAENSHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKLEQEARVLVSSGQTEVLEQ
  LKALQMDITSLYNLKFQPPTLGPEPAARTPEGSPVHGSGPSKDSFGELSRATIRLLEELDRERCFLLNEIEKEEK
  EKLWYYSQLQGLSKRLDELPHVETQFSMQMDLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDKE
  LLEAQDRVQQTEPQALLAVKSVPVDEDPETEVPTHPEDGTPQPGNSKVEVVFWLLSMLATRDQEDTARTLLAMSS
  SPESCVAMRRSGCLPLLLQILHGTEAAAGGRAGAPGAPGAKDARMRANAALHNIVFSQPDQGLARKEMRVLHVLE
  QIRAYCETCWDWLQARDGGPEGGGAGSAPIPIEPQICQATCAVMKLSFDEEYRRAMNELGGLQAVAELLQVDYEM
  HKMTRDPLNLALRRYAGMTLTNLTFGDVANKATLCARRGCMEAIVAQLASDSEELHQVVSSILRNLSWRADINSK
  KVLREAGSVTALVQCVLRATKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAIIESG
  GGILRNVSSLVATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSARDQELLWDLGAVGMLRNL
  VHSKHKMIAMGSAAALRNLLAHRPAKHQAAATAVSPGSCVPSLYVRKQRALEAELDARHLAQALEHLEKQGPPAA
  EAATKKPLPPLRHLDGLAQDYASDSGCFDDDDAPSSLAAAAATGEPASPAALSLFLGSPFLQGQALARTPPTRRG
  GKEAEKDTSGEAAVAAKAKAKLALAVARIDQLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCRGPEG
  GRREAGSRAHPLLRLKAAHASLSNDSLNSGSASDGYCPREHMLPCPLAALASRREDPRCGQPRPSRLDLDLPGCQ
  AEPPAREATSADARVRTIKLSPTYQHVPLLEGASRAGAEPLAGPGISPGARKQAWLPADHLSKVPEKLAAAPLSV
  ASKALQKLAAQEGPLSLSRCSSLSSLSSAGRPGPSEGGDLDDSDSSLEGLEEAGPSEAELDSTWRAPGATSLPVA
  IPAPRRNRGRGLGVEDATPSSSSENYVQETPLVLSRCSSVSSLGSFESPSIASSIPSEPCSGQGSGTISPSELPD
  SPGQTMPPSRSKTPPLAPAPQGPPEATQFSLQWESYVKRFLDIADCRERCRLPSELDAGSVRFTVEKPDENFSCA
  SSLSALALHEHYVQQDVELRLLPSACPERGGGAGGAGLHFAGHRRREEGPAPTGSRPRGAADQELELLRECLGAA
  VPARLRKVASALVPGRRALPVPVYMLVPAPAPAQEDDSCTDSAEGTPVNFSSAASLSDETLQGPPRDQPGGPAGR
  QRPTGRPTSARQAMGHRHKAGGAGRSAEQSRGAGKNRAGLELPLGRPPSAPADKDGSKPGRTRGDGALQSLCLTT
  PTEEAVYCFYGNDSDEEPPAAAPTPTHRRTSAIPRAFTRERPQGRKEAPAPSKAAPAAPPPARTQPSLIADETPP
  CYSLSSSASSLSEPEPSEPPAVHPRGREPAVTKDPGPGGGRDSSPSPRAAEELLQRCISSALPRRRPPVSGLRRR
  KPRATRLDERPAEGSRERGEEAAGSDRASDLDSVEWRAIQEGANSIVTWLHQAAAATREASSESDSILSFVSGLS
  VGSTLQPPKHRKGRQAEGEMGSARRPEKRGAASVKTSGSPRSPAGPEKPRGTQKTTPGVPAVLRGRTVIYVPSPA
  PRAQPKGTPGPRATPRKVAPPCLAQPAAPAKVPSPGQQRSRSLHRPAKTSELATLSQPPRSATPPARLAKTPSSS
  SSQTSPASQPLPRKRPPVTQAAGALPGPGASPVPKTPARTLLAKQHKTQRSPVRIPFMQRPARRGPPPLARAVPE
  PGPRGRAGTEAGPGARGGRLGLVRVASALSSGSESSDRSGFRRQLTFIKESPGLRRRRSELSSAESAASAPQGAS
  PRRGRPALPAVFLCSSRCEELRAAPRQGPAPARQRPPAARPSPGERPARRTTSESPSRLPVRAPAARPETVKRYA
  SLPHISVARRPDGAVPAAPASADAARRSSDGEPRPLPRVAAPGTTWRRIRDEDVPHILRSTLPATALPLRGSTPE
  DAPAGPPPRKTSDAVVQTEEVAAPKTNSSTSPSLETREPPGAPAGGQLSLLGSDVDGPSLAKAPISAPFVHEGLG
  VAVGGFPASRHGSPSRSARVPPFNYVPSPMVVAATTDSAAEKAPATASATLLE

• Structural information:
  • Interpro: IPR026837  IPR009234  IPR026831  IPR026818  IPR032038   IPR036149  IPR041257  IPR009223  IPR011989  IPR016024  IPR000225  IPR009224  
  • STRING: ENSP00000442954
• Other Databases: GeneCards:  APC2  Malacards:  APC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045732	positive regulation of protein catabolic process	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0008013	beta-catenin binding	IBA	molecular function
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0045595	regulation of cell differentiation	IBA	biological process
GO:0045295	gamma-catenin binding	IBA	molecular function
GO:0030877	beta-catenin destruction complex	IBA	cellular component
GO:0007389	pattern specification process	IBA	biological process
GO:0007026	negative regulation of microtubule depolymerization	IBA	biological process
GO:0005881	cytoplasmic microtubule	IBA	colocalizes with
GO:0001708	cell fate specification	IBA	biological process
GO:0031941	filamentous actin	IDA	colocalizes with
GO:0005881	cytoplasmic microtubule	IDA	colocalizes with
GO:0090630	activation of GTPase activity	IMP	biological process
GO:0000226	microtubule cytoskeleton organization	IMP	biological process
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0016342	catenin complex	IDA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098794	postsynapse	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	colocalizes with
GO:0005881	cytoplasmic microtubule	IDA	colocalizes with
GO:0005884	actin filament	IDA	cellular component
GO:0031258	lamellipodium membrane	IDA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05206	MicroRNAs in cancer
hsa04810	Regulation of actin cytoskeleton
hsa04310	Wnt signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa05210	Colorectal cancer
hsa05217	Basal cell carcinoma
hsa05213	Endometrial cancer

Diseases

Associated diseases	References
Colorectal cancer	KEGG:H00020
Medulloblastoma	KEGG:H01667
Colorectal cancer	KEGG:H00020
Medulloblastoma	KEGG:H01667
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq