• Gene id: 10294

Gene Summary

• Gene Symbol: DNAJA2   Gene   UCSC   Ensembl
• Aliases: CPR3, DJ3, DJA2, DNAJ, DNJ3, HIRIP4, PRO3015, RDJ2
• Gene name: DnaJ heat shock protein family (Hsp40) member A2
• Alternate names: dnaJ homolog subfamily A member 2, DnaJ (Hsp40) homolog, subfamily A, member 2, HIRA interacting protein 4, cell cycle progression 3 protein, cell cycle progression restoration gene 3 protein, renal carcinoma antigen NY-REN-14,
• Gene location: 16q11.2 (46973673: 46955361)     Exons: 9     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid
• OMIM: 611322

Protein Summary

• Protein general information: O60884  
  • Name: DnaJ homolog subfamily A member 2 (Cell cycle progression restoration gene 3 protein) (Dnj3) (Dj3) (HIRA interacting protein 4) (Renal carcinoma antigen NY REN 14)
  • Length: 412  
  • Mass: 45746
• Sequence:

  MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLR
  EGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQG
  GKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGM
  KHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVKYPP
  GKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSRPEVPNIIGETEEVELQE
  FDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ

• Structural information:
  • Protein Domains: (8..7-)
    (/note="J"-)
  • Interpro: IPR012724  IPR002939  IPR001623  IPR018253  IPR008971   IPR001305  IPR036410  IPR036869  
  • Prosite: PS00636 PS50076 PS51188
  • CDD: cd06257 cd10719
  • DIP: 33143
  • STRING: ENSP00000314030
• Other Databases: GeneCards:  DNAJA2  Malacards:  DNAJA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0001671	ATPase activator activity	IDA	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0009408	response to heat	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0031072	heat shock protein binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0032781	positive regulation of ATPase activity	IEA	biological process
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0042026	protein refolding	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881