• Gene id: 10293

Gene Summary

• Gene Symbol: TRAIP   Gene   UCSC   Ensembl
• Aliases: RNF206, SCKL9, TRIP
• Gene name: TRAF interacting protein
• Alternate names: E3 ubiquitin-protein ligase TRAIP, RING-type E3 ubiquitin transferase TRAIP, ring finger protein 206,
• Gene location: 3p21.31 (49856583: 49828594)     Exons: 16     NC_000003.12
• Gene summary(Entrez): This gene encodes a protein that contains an N-terminal RING finger motif and a putative coiled-coil domain. A similar murine protein interacts with TNFR-associated factor 1 (TRAF1), TNFR-associated factor 2 (TRAF2), and cylindromatosis. The interaction w
• OMIM: 601488

Protein Summary

• Protein general information: Q9BWF2  
  • Name: E3 ubiquitin protein ligase TRAIP (EC 2.3.2.27) (RING finger protein 206) (RING type E3 ubiquitin transferase TRAIP) (TRAF interacting protein)
  • Length: 469  
  • Mass: 53294
• Sequence:

  MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIINKLFFDLAQEEENVLD
  AEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMKYLEQQQDETK
  QAQEEARRLRSKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGEVADKL
  RKDLFSSRSKLQTVYSELDQAKLELKSAQKDLQSADKEIMSLKKKLTMLQETLNLPPVASETVDRLVLESPAPVE
  VNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQDVPKKICKGPRKESQLSLGGQSCAG
  EPDEELVGAFPIFVRNAILGQKQPKRPRSESSCSKDVVRTGFDGLGGRTKFIQPTDTVMIRPLPVKPKTKVKQRV
  RVKTVPSLFQAKLDTFLWS

• Structural information:
  • Interpro: IPR001841  IPR013083  
  • Prosite: PS50089
  • PDB: 4ZTD
  • PDBsum: 4ZTD
  • STRING: ENSP00000328203
• Other Databases: GeneCards:  TRAIP  Malacards:  TRAIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IDA	cellular component
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0032688	negative regulation of interferon-beta production	IEA	biological process
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Seckel syndrome	KEGG:H00992
Seckel syndrome	KEGG:H00992
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881