• Gene id: 10287

Gene Summary

• Gene Symbol: RGS19   Gene   UCSC   Ensembl
• Aliases: GAIP, RGSGAIP
• Gene name: regulator of G protein signaling 19
• Alternate names: regulator of G-protein signaling 19, G alpha interacting protein, G protein signalling regulator 19, guanine nucleotide binding protein alpha inhibiting activity polypeptide 3 interacting protein, regulator of G-protein signalling 19,
• Gene location: 20q13.33 (64080003: 64073180)     Exons: 8     NC_000020.11
• Gene summary(Entrez): G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protei
• OMIM: 609574

Protein Summary

• Protein general information: P49795  
  • Name: Regulator of G protein signaling 19 (RGS19) (G alpha interacting protein) (GAIP)
  • Length: 217  
  • Mass: 24636
  • Tissue specificity: Highest expression in lung. Placenta, liver and heart also express high levels of GAIP.
• Sequence:

  MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEV
  CATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSIL
  SPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA

• Structural information:
  • Protein Domains: (90..20-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171"-)
  • Interpro: IPR016137  IPR036305  
  • Prosite: PS50132
  • PDB: 1CMZ
  • PDBsum: 1CMZ
  • STRING: ENSP00000378483
• Other Databases: GeneCards:  RGS19  Malacards:  RGS19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007264	small GTPase mediated signal transduction	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045471	response to ethanol	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0030136	clathrin-coated vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R