• Gene id: 10276

Gene Summary

• Gene Symbol: NET1   Gene   UCSC   Ensembl
• Aliases: ARHGEF8, NET1A
• Gene name: neuroepithelial cell transforming 1
• Alternate names: neuroepithelial cell-transforming gene 1 protein, Rho guanine nucleotide exchange factor (GEF) 8, epididymis secretory sperm binding protein, guanine nucleotide regulatory protein (oncogene), neuroepithelioma transforming gene 1, p65 Net1 proto-oncogene protei,
• Gene location: 10p15.1 (5412556: 5459055)     Exons: 13     NC_000010.11
• Gene summary(Entrez): This gene is part of the family of Rho guanine nucleotide exchange factors. Members of this family activate Rho proteins by catalyzing the exchange of GDP for GTP. The protein encoded by this gene interacts with RhoA within the cell nucleus and may play a
• OMIM: 611248

Protein Summary

• Protein general information: Q7Z628  
  • Name: Neuroepithelial cell transforming gene 1 protein (Proto oncogene p65 Net1) (Rho guanine nucleotide exchange factor 8)
  • Length: 596  
  • Mass: 67740
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MEPELAAQKQPRPRRRSRRASGLSTEGATGPSADTSGSELDGRCSLRRGSSFTFLTPGPNWDFTLKRKRREKDDD
  VVSLSSLDLKEPSNKRVRPLARVTSLANLISPVRNGAVRRFGQTIQSFTLRGDHRSPASAQKFSSRSTVPTPAKR
  RSSALWSEMLDITMKESLTTREIRRQEAIYEMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDSY
  IPLHEDLLTRIGEATKPDGTVEQIGHILVSWLPRLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSR
  KLDLWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDAILIIQGVLSDINLKKGESECQYYIDKLEYLDEK
  QRDPRIEASKVLLCHGELRSKSGHKLYIFLFQDILVLTRPVTRNERHSYQVYRQPIPVQELVLEDLQDGDVRMGG
  SFRGAFSNSEKAKNIFRIRFHDPSPAQSHTLQANDVFHKQQWFNCIRAAIAPFQSAGSPPELQGLPELHEECEGN
  HPSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV

• Structural information:
  • Protein Domains: (174..35-)
    (/note="DH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00062-)
    (386..50-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR035899  IPR000219  IPR001331  IPR037853  IPR011993   IPR001849  
  • Prosite: PS00741 PS50010 PS50003
  • CDD: cd13224 cd00160
  • PDB: 3EO2 4XH9
  • PDBsum: 3EO2 4XH9
  • STRING: ENSP00000347134
• Other Databases: GeneCards:  NET1  Malacards:  NET1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005089	Rho guanyl-nucleotide exchange factor activity	IBA	molecular function
GO:0035025	positive regulation of Rho protein signal transduction	IBA	biological process
GO:0071479	cellular response to ionizing radiation	IDA	biological process
GO:0070301	cellular response to hydrogen peroxide	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043547	positive regulation of GTPase activity	IMP	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051451	myoblast migration	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001558	regulation of cell growth	NAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq